From patchwork Thu Aug 10 19:17:36 2023 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: "Rafael J. Wysocki" X-Patchwork-Id: 13349855 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from vger.kernel.org (vger.kernel.org [23.128.96.18]) by smtp.lore.kernel.org (Postfix) with ESMTP id 433FEC001E0 for ; Thu, 10 Aug 2023 19:17:48 +0000 (UTC) Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S230327AbjHJTRr (ORCPT ); Thu, 10 Aug 2023 15:17:47 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:53808 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S235884AbjHJTRq (ORCPT ); Thu, 10 Aug 2023 15:17:46 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id 01D7A2702; Thu, 10 Aug 2023 12:17:45 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.2.0) id ff766902256c742a; Thu, 10 Aug 2023 21:17:44 +0200 Authentication-Results: v370.home.net.pl; spf=softfail (domain owner discourages use of this host) smtp.mailfrom=rjwysocki.net (client-ip=195.136.19.94; helo=[195.136.19.94]; envelope-from=rjw@rjwysocki.net; receiver=) Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id 0FBD1662742; Thu, 10 Aug 2023 21:17:44 +0200 (CEST) From: "Rafael J. Wysocki" To: Linux PM Cc: LKML , Srinivas Pandruvada , Zhang Rui , Daniel Lezcano Subject: [PATCH v1 7/7] thermal: intel: intel_soc_dts_iosf: Use struct thermal_trip Date: Thu, 10 Aug 2023 21:17:36 +0200 Message-ID: <2249203.iZASKD2KPV@kreacher> In-Reply-To: <5713357.DvuYhMxLoT@kreacher> References: <5713357.DvuYhMxLoT@kreacher> MIME-Version: 1.0 X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedviedrleeigddufeegucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecujffqoffgrffnpdggtffipffknecuuegrihhlohhuthemucduhedtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjughrpefhvfevufffkfgjfhgggfgtsehtufertddttdejnecuhfhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqnecuggftrfgrthhtvghrnhepvdffueeitdfgvddtudegueejtdffteetgeefkeffvdeftddttdeuhfegfedvjefhnecukfhppeduleehrddufeeirdduledrleegnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepudelhedrudefiedrudelrdelgedphhgvlhhopehkrhgvrggthhgvrhdrlhhotggrlhhnvghtpdhmrghilhhfrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqedpnhgspghrtghpthhtohephedprhgtphhtthhopehlihhnuhigqdhpmhesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehlihhnuhigqdhkvghrnhgvlhesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehsrhhinhhivhgrshdrphgrnhgurhhuvhgruggrsehlihhnuhigrdhinhhtvghlrdgtohhmpdhrtghpthhtoheprhhuihdriihhrghnghesihhnthgvlhdrtghomhdp rhgtphhtthhopegurghnihgvlhdrlhgviigtrghnoheslhhinhgrrhhordhorhhg X-DCC--Metrics: v370.home.net.pl 1024; Body=5 Fuz1=5 Fuz2=5 Precedence: bulk List-ID: X-Mailing-List: linux-pm@vger.kernel.org From: Rafael J. Wysocki Because the number of trip points in each thermal zone and their types are known to intel_soc_dts_iosf_init() prior to the registration of the thermal zones, make it create an array of struct thermal_trip entries in each struct intel_soc_dts_sensor_entry object and make add_dts_thermal_zone() use thermal_zone_device_register_with_trips() for thermal zone registration and pass that array as its second argument. Drop the sys_get_trip_temp() and sys_get_trip_type() callback functions along with the respective callback pointers in tzone_ops, because they are not necessary any more. Signed-off-by: Rafael J. Wysocki --- drivers/thermal/intel/intel_soc_dts_iosf.c | 51 +++-------------------------- drivers/thermal/intel/intel_soc_dts_iosf.h | 2 - 2 files changed, 8 insertions(+), 45 deletions(-) Index: linux-pm/drivers/thermal/intel/intel_soc_dts_iosf.h =================================================================== --- linux-pm.orig/drivers/thermal/intel/intel_soc_dts_iosf.h +++ linux-pm/drivers/thermal/intel/intel_soc_dts_iosf.h @@ -29,7 +29,7 @@ struct intel_soc_dts_sensor_entry { int id; u32 store_status; u32 trip_mask; - enum thermal_trip_type trip_types[SOC_MAX_DTS_TRIPS]; + struct thermal_trip trips[SOC_MAX_DTS_TRIPS]; struct thermal_zone_device *tzone; struct intel_soc_dts_sensors *sensors; }; Index: linux-pm/drivers/thermal/intel/intel_soc_dts_iosf.c =================================================================== --- linux-pm.orig/drivers/thermal/intel/intel_soc_dts_iosf.c +++ linux-pm/drivers/thermal/intel/intel_soc_dts_iosf.c @@ -40,32 +40,6 @@ /* Mask for two trips in status bits */ #define SOC_DTS_TRIP_MASK 0x03 -static int sys_get_trip_temp(struct thermal_zone_device *tzd, int trip, - int *temp) -{ - int status; - u32 out; - struct intel_soc_dts_sensor_entry *dts; - struct intel_soc_dts_sensors *sensors; - - dts = thermal_zone_device_priv(tzd); - sensors = dts->sensors; - mutex_lock(&sensors->dts_update_lock); - status = iosf_mbi_read(BT_MBI_UNIT_PMC, MBI_REG_READ, - SOC_DTS_OFFSET_PTPS, &out); - mutex_unlock(&sensors->dts_update_lock); - if (status) - return status; - - out = (out >> (trip * 8)) & SOC_DTS_TJMAX_ENCODING; - if (!out) - *temp = 0; - else - *temp = sensors->tj_max - out * 1000; - - return 0; -} - static int update_trip_temp(struct intel_soc_dts_sensors *sensors, int thres_index, int temp) { @@ -165,7 +139,8 @@ static int configure_trip(struct intel_s if (ret) return ret; - dts->trip_types[thres_index] = trip_type; + dts->trips[thres_index].temperature = temp; + dts->trips[thres_index].type = trip_type; return 0; } @@ -187,16 +162,6 @@ static int sys_set_trip_temp(struct ther return status; } -static int sys_get_trip_type(struct thermal_zone_device *tzd, - int trip, enum thermal_trip_type *type) -{ - struct intel_soc_dts_sensor_entry *dts = thermal_zone_device_priv(tzd); - - *type = dts->trip_types[trip]; - - return 0; -} - static int sys_get_curr_temp(struct thermal_zone_device *tzd, int *temp) { @@ -221,8 +186,6 @@ static int sys_get_curr_temp(struct ther static struct thermal_zone_device_ops tzone_ops = { .get_temp = sys_get_curr_temp, - .get_trip_temp = sys_get_trip_temp, - .get_trip_type = sys_get_trip_type, .set_trip_temp = sys_set_trip_temp, }; @@ -293,11 +256,11 @@ static int add_dts_thermal_zone(int id, } dts->trip_mask = trip_mask; snprintf(name, sizeof(name), "soc_dts%d", id); - dts->tzone = thermal_zone_device_register(name, - SOC_MAX_DTS_TRIPS, - trip_mask, - dts, &tzone_ops, - NULL, 0, 0); + dts->tzone = thermal_zone_device_register_with_trips(name, dts->trips, + SOC_MAX_DTS_TRIPS, + trip_mask, + dts, &tzone_ops, + NULL, 0, 0); if (IS_ERR(dts->tzone)) { ret = PTR_ERR(dts->tzone); goto err_ret;