From patchwork Fri Jul 21 12:46:38 2023 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: "Rafael J. Wysocki" X-Patchwork-Id: 13322066 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from vger.kernel.org (vger.kernel.org [23.128.96.18]) by smtp.lore.kernel.org (Postfix) with ESMTP id E9CBAEB64DC for ; Fri, 21 Jul 2023 14:07:32 +0000 (UTC) Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S231758AbjGUOHb (ORCPT ); Fri, 21 Jul 2023 10:07:31 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:32880 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S231641AbjGUOH1 (ORCPT ); Fri, 21 Jul 2023 10:07:27 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id 3CA58273F; Fri, 21 Jul 2023 07:07:24 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.2.0) id 3dc22f17bb37cb2b; Fri, 21 Jul 2023 16:07:22 +0200 Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id 3E98A6618EA; Fri, 21 Jul 2023 16:07:22 +0200 (CEST) From: "Rafael J. Wysocki" To: Linux ACPI Cc: LKML , Linux PM , Michal Wilczynski , Zhang Rui , Srinivas Pandruvada , Daniel Lezcano Subject: [PATCH v2 1/8] thermal: core: Add mechanism for connecting trips with driver data Date: Fri, 21 Jul 2023 14:46:38 +0200 Message-ID: <4862397.31r3eYUQgx@kreacher> In-Reply-To: <5710197.DvuYhMxLoT@kreacher> References: <13318886.uLZWGnKmhe@kreacher> <5710197.DvuYhMxLoT@kreacher> MIME-Version: 1.0 X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedviedrhedvgdeikecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfjqffogffrnfdpggftiffpkfenuceurghilhhouhhtmecuudehtdenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhephffvvefufffkjghfggfgtgesthfuredttddtjeenucfhrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqeenucggtffrrghtthgvrhhnpedvffeuiedtgfdvtddugeeujedtffetteegfeekffdvfedttddtuefhgeefvdejhfenucfkphepudelhedrudefiedrudelrdelgeenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpeduleehrddufeeirdduledrleegpdhhvghlohepkhhrvggrtghhvghrrdhlohgtrghlnhgvthdpmhgrihhlfhhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqpdhnsggprhgtphhtthhopeejpdhrtghpthhtoheplhhinhhugidqrggtphhisehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqkhgvrhhnvghlsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqphhmsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtohepmhhitghhrghlrdifihhltgiihihnshhkihesihhnthgvlhdrtghomhdprhgt phhtthhopehruhhirdiihhgrnhhgsehinhhtvghlrdgtohhmpdhrtghpthhtohepshhrihhnihhvrghsrdhprghnughruhhvrggurgeslhhinhhugidrihhnthgvlhdrtghomh X-DCC--Metrics: v370.home.net.pl 1024; Body=7 Fuz1=7 Fuz2=7 Precedence: bulk List-ID: X-Mailing-List: linux-pm@vger.kernel.org From: Rafael J. Wysocki Some drivers need to update trip point data (temperature and/or hysteresis) upon notifications from the platform firmware or they may need to reprogram hardware when trip point parameters are changed via sysfs. For those purposes, they need to connect struct thermal_trip to a private data set associated with the trip or the other way around and using a trip point index for that may not always work, because the core may need to reorder the trips during thermal zone registration (in particular, they may need to be sorted). To allow that to be done without using a trip point index, introduce a new field in struct thermal_trip that can be pointed by the driver to its own data structure containing a trip pointer to be initialized by the core during thermal zone registration. That pointer will then have to be updated by the core every time the location of the given trip point object in memory changes. Signed-off-by: Rafael J. Wysocki --- v1 -> v2: No changes. --- drivers/thermal/thermal_core.c | 20 +++++++++++++++++--- include/linux/thermal.h | 13 +++++++++++++ 2 files changed, 30 insertions(+), 3 deletions(-) Index: linux-pm/include/linux/thermal.h =================================================================== --- linux-pm.orig/include/linux/thermal.h +++ linux-pm/include/linux/thermal.h @@ -76,16 +76,29 @@ struct thermal_zone_device_ops { void (*critical)(struct thermal_zone_device *); }; +struct thermal_trip_ref { + struct thermal_trip *trip; +}; + /** * struct thermal_trip - representation of a point in temperature domain * @temperature: temperature value in miliCelsius * @hysteresis: relative hysteresis in miliCelsius * @type: trip point type + * @driver_ref: driver's reference to this trip point + * + * If @driver_ref is not NULL, the trip pointer in the object pointed to by it + * will be initialized by the core during thermal zone registration and updated + * whenever the location of the given trip object changes. This allows the + * driver to access the trip point data without knowing the relative ordering + * of trips within the trip table used by the core and, given a trip pointer, + * to get back to its private data associated with the given trip. */ struct thermal_trip { int temperature; int hysteresis; enum thermal_trip_type type; + struct thermal_trip_ref *driver_ref; }; struct thermal_cooling_device_ops { Index: linux-pm/drivers/thermal/thermal_core.c =================================================================== --- linux-pm.orig/drivers/thermal/thermal_core.c +++ linux-pm/drivers/thermal/thermal_core.c @@ -1306,14 +1306,28 @@ thermal_zone_device_register_with_trips( if (result) goto release_device; + mutex_lock(&tz->lock); + for (count = 0; count < num_trips; count++) { - struct thermal_trip trip; + int temperature = 0; + + if (trips) { + temperature = trips[count].temperature; + if (trips[count].driver_ref) + trips[count].driver_ref->trip = &trips[count]; + } else { + struct thermal_trip trip; - result = thermal_zone_get_trip(tz, count, &trip); - if (result || !trip.temperature) + result = __thermal_zone_get_trip(tz, count, &trip); + if (!result) + temperature = trip.temperature; + } + if (!temperature) set_bit(count, &tz->trips_disabled); } + mutex_unlock(&tz->lock); + /* Update 'this' zone's governor information */ mutex_lock(&thermal_governor_lock); From patchwork Fri Jul 21 12:47:47 2023 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: "Rafael J. Wysocki" X-Patchwork-Id: 13322064 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from vger.kernel.org (vger.kernel.org [23.128.96.18]) by smtp.lore.kernel.org (Postfix) with ESMTP id 2482CEB64DC for ; Fri, 21 Jul 2023 14:07:30 +0000 (UTC) Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S231622AbjGUOH2 (ORCPT ); Fri, 21 Jul 2023 10:07:28 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:32874 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S231625AbjGUOH1 (ORCPT ); Fri, 21 Jul 2023 10:07:27 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id E1A2B10A; Fri, 21 Jul 2023 07:07:23 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.2.0) id e3471599fb4ca902; Fri, 21 Jul 2023 16:07:22 +0200 Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id 961476618ED; Fri, 21 Jul 2023 16:07:21 +0200 (CEST) From: "Rafael J. Wysocki" To: Linux ACPI Cc: LKML , Linux PM , Michal Wilczynski , Zhang Rui , Srinivas Pandruvada , Daniel Lezcano Subject: [PATCH v2 2/8] thermal: core: Do not handle trip points with invalid temperature Date: Fri, 21 Jul 2023 14:47:47 +0200 Message-ID: <2306949.ElGaqSPkdT@kreacher> In-Reply-To: <5710197.DvuYhMxLoT@kreacher> References: <13318886.uLZWGnKmhe@kreacher> <5710197.DvuYhMxLoT@kreacher> MIME-Version: 1.0 X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedviedrhedvgdeikecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfjqffogffrnfdpggftiffpkfenuceurghilhhouhhtmecuudehtdenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhephffvvefufffkjghfggfgtgesthfuredttddtjeenucfhrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqeenucggtffrrghtthgvrhhnpedvffeuiedtgfdvtddugeeujedtffetteegfeekffdvfedttddtuefhgeefvdejhfenucfkphepudelhedrudefiedrudelrdelgeenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpeduleehrddufeeirdduledrleegpdhhvghlohepkhhrvggrtghhvghrrdhlohgtrghlnhgvthdpmhgrihhlfhhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqpdhnsggprhgtphhtthhopeejpdhrtghpthhtoheplhhinhhugidqrggtphhisehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqkhgvrhhnvghlsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqphhmsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtohepmhhitghhrghlrdifihhltgiihihnshhkihesihhnthgvlhdrtghomhdprhgt phhtthhopehruhhirdiihhgrnhhgsehinhhtvghlrdgtohhmpdhrtghpthhtohepshhrihhnihhvrghsrdhprghnughruhhvrggurgeslhhinhhugidrihhnthgvlhdrtghomh X-DCC--Metrics: v370.home.net.pl 1024; Body=7 Fuz1=7 Fuz2=7 Precedence: bulk List-ID: X-Mailing-List: linux-pm@vger.kernel.org From: Rafael J. Wysocki Trip points with temperature set to THERMAL_TEMP_INVALID are as good as disabled, so make handle_thermal_trip() ignore them. Signed-off-by: Rafael J. Wysocki --- v1 -> v2: No changes. --- drivers/thermal/thermal_core.c | 3 ++- 1 file changed, 2 insertions(+), 1 deletion(-) Index: linux-pm/drivers/thermal/thermal_core.c =================================================================== --- linux-pm.orig/drivers/thermal/thermal_core.c +++ linux-pm/drivers/thermal/thermal_core.c @@ -348,7 +348,8 @@ static void handle_thermal_trip(struct t struct thermal_trip trip; /* Ignore disabled trip points */ - if (test_bit(trip_id, &tz->trips_disabled)) + if (test_bit(trip_id, &tz->trips_disabled) || + trip.temperature == THERMAL_TEMP_INVALID) return; __thermal_zone_get_trip(tz, trip_id, &trip); From patchwork Fri Jul 21 12:50:44 2023 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: "Rafael J. Wysocki" X-Patchwork-Id: 13322065 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from vger.kernel.org (vger.kernel.org [23.128.96.18]) by smtp.lore.kernel.org (Postfix) with ESMTP id C0505C04A6A for ; Fri, 21 Jul 2023 14:07:31 +0000 (UTC) Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S231749AbjGUOHa (ORCPT ); Fri, 21 Jul 2023 10:07:30 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:32876 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S231631AbjGUOH1 (ORCPT ); Fri, 21 Jul 2023 10:07:27 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id E1ADD1BE2; Fri, 21 Jul 2023 07:07:23 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.2.0) id ff9927f48c58abfd; Fri, 21 Jul 2023 16:07:21 +0200 Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id DD54D6618EA; Fri, 21 Jul 2023 16:07:20 +0200 (CEST) From: "Rafael J. Wysocki" To: Linux ACPI Cc: LKML , Linux PM , Michal Wilczynski , Zhang Rui , Srinivas Pandruvada , Daniel Lezcano Subject: [PATCH v2 3/8] thermal: core: Add routines for locking and unlocking thermal zones Date: Fri, 21 Jul 2023 14:50:44 +0200 Message-ID: <2167475.irdbgypaU6@kreacher> In-Reply-To: <5710197.DvuYhMxLoT@kreacher> References: <13318886.uLZWGnKmhe@kreacher> <5710197.DvuYhMxLoT@kreacher> MIME-Version: 1.0 X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedviedrhedvgdeikecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfjqffogffrnfdpggftiffpkfenuceurghilhhouhhtmecuudehtdenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhephffvvefufffkjghfggfgtgesthfuredttddtjeenucfhrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqeenucggtffrrghtthgvrhhnpedvffeuiedtgfdvtddugeeujedtffetteegfeekffdvfedttddtuefhgeefvdejhfenucfkphepudelhedrudefiedrudelrdelgeenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpeduleehrddufeeirdduledrleegpdhhvghlohepkhhrvggrtghhvghrrdhlohgtrghlnhgvthdpmhgrihhlfhhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqpdhnsggprhgtphhtthhopeejpdhrtghpthhtoheplhhinhhugidqrggtphhisehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqkhgvrhhnvghlsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqphhmsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtohepmhhitghhrghlrdifihhltgiihihnshhkihesihhnthgvlhdrtghomhdprhgt phhtthhopehruhhirdiihhgrnhhgsehinhhtvghlrdgtohhmpdhrtghpthhtohepshhrihhnihhvrghsrdhprghnughruhhvrggurgeslhhinhhugidrihhnthgvlhdrtghomh X-DCC--Metrics: v370.home.net.pl 1024; Body=7 Fuz1=7 Fuz2=7 Precedence: bulk List-ID: X-Mailing-List: linux-pm@vger.kernel.org From: Rafael J. Wysocki Add thermal_zone_device_lock() and thermal_zone_device_unlock() for acquiring and releasing the thermal zone lock, respectively. They will be used by the ACPI thermal driver to protect trip point temperature updates against races with accesses from elsewhere. Signed-off-by: Rafael J. Wysocki --- v1 -> v2: New patch. --- drivers/thermal/thermal_core.c | 13 +++++++++++++ include/linux/thermal.h | 2 ++ 2 files changed, 15 insertions(+) Index: linux-pm/drivers/thermal/thermal_core.c =================================================================== --- linux-pm.orig/drivers/thermal/thermal_core.c +++ linux-pm/drivers/thermal/thermal_core.c @@ -497,6 +498,18 @@ void thermal_zone_device_update(struct t } EXPORT_SYMBOL_GPL(thermal_zone_device_update); +void thermal_zone_device_lock(struct thermal_zone_device *tz) +{ + mutex_lock(&tz->lock); +} +EXPORT_SYMBOL_GPL(thermal_zone_device_lock); + +void thermal_zone_device_unlock(struct thermal_zone_device *tz) +{ + mutex_unlock(&tz->lock); +} +EXPORT_SYMBOL_GPL(thermal_zone_device_unlock); + static void thermal_zone_device_check(struct work_struct *work) { struct thermal_zone_device *tz = container_of(work, struct Index: linux-pm/include/linux/thermal.h =================================================================== --- linux-pm.orig/include/linux/thermal.h +++ linux-pm/include/linux/thermal.h @@ -336,6 +336,8 @@ int thermal_zone_unbind_cooling_device(s struct thermal_cooling_device *); void thermal_zone_device_update(struct thermal_zone_device *, enum thermal_notify_event); +void thermal_zone_device_lock(struct thermal_zone_device *tz); +void thermal_zone_device_unlock(struct thermal_zone_device *tz); struct thermal_cooling_device *thermal_cooling_device_register(const char *, void *, const struct thermal_cooling_device_ops *); From patchwork Fri Jul 21 14:12:35 2023 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: "Rafael J. Wysocki" X-Patchwork-Id: 13322131 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from vger.kernel.org (vger.kernel.org [23.128.96.18]) by smtp.lore.kernel.org (Postfix) with ESMTP id D2446EB64DC for ; Fri, 21 Jul 2023 15:18:22 +0000 (UTC) Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S231892AbjGUPSV (ORCPT ); Fri, 21 Jul 2023 11:18:21 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:52974 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S231712AbjGUPSR (ORCPT ); Fri, 21 Jul 2023 11:18:17 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id 5B26C30E2; Fri, 21 Jul 2023 08:18:15 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.2.0) id 87413cbeceb04564; Fri, 21 Jul 2023 17:18:13 +0200 Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id 5061F661901; Fri, 21 Jul 2023 17:18:13 +0200 (CEST) From: "Rafael J. Wysocki" To: Linux ACPI Cc: LKML , Linux PM , Michal Wilczynski , Zhang Rui , Srinivas Pandruvada , Daniel Lezcano Subject: [PATCH v2 4/8] ACPI: thermal: Clean up acpi_thermal_register_thermal_zone() Date: Fri, 21 Jul 2023 16:12:35 +0200 Message-ID: <2908953.e9J7NaK4W3@kreacher> In-Reply-To: <5710197.DvuYhMxLoT@kreacher> References: <13318886.uLZWGnKmhe@kreacher> <5710197.DvuYhMxLoT@kreacher> MIME-Version: 1.0 X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedviedrhedvgdekvdcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfjqffogffrnfdpggftiffpkfenuceurghilhhouhhtmecuudehtdenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhephffvvefufffkjghfggfgtgesthfuredttddtjeenucfhrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqeenucggtffrrghtthgvrhhnpedvffeuiedtgfdvtddugeeujedtffetteegfeekffdvfedttddtuefhgeefvdejhfenucfkphepudelhedrudefiedrudelrdelgeenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpeduleehrddufeeirdduledrleegpdhhvghlohepkhhrvggrtghhvghrrdhlohgtrghlnhgvthdpmhgrihhlfhhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqpdhnsggprhgtphhtthhopeejpdhrtghpthhtoheplhhinhhugidqrggtphhisehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqkhgvrhhnvghlsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqphhmsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtohepmhhitghhrghlrdifihhltgiihihnshhkihesihhnthgvlhdrtghomhdprhgt phhtthhopehruhhirdiihhgrnhhgsehinhhtvghlrdgtohhmpdhrtghpthhtohepshhrihhnihhvrghsrdhprghnughruhhvrggurgeslhhinhhugidrihhnthgvlhdrtghomh X-DCC--Metrics: v370.home.net.pl 1024; Body=7 Fuz1=7 Fuz2=7 Precedence: bulk List-ID: X-Mailing-List: linux-pm@vger.kernel.org From: Rafael J. Wysocki Rename the trips variable in acpi_thermal_register_thermal_zone() to trip_count so its name better reflects the purpose, rearrange white space in the loop over active trips for clarity and reduce code duplication related to calling thermal_zone_device_register() by using an extra local variable to store the passive delay value. No intentional functional impact. Signed-off-by: Rafael J. Wysocki --- v1 -> v2: No changes. --- drivers/acpi/thermal.c | 36 ++++++++++++++++-------------------- 1 file changed, 16 insertions(+), 20 deletions(-) Index: linux-pm/drivers/acpi/thermal.c =================================================================== --- linux-pm.orig/drivers/acpi/thermal.c +++ linux-pm/drivers/acpi/thermal.c @@ -745,34 +745,30 @@ static void acpi_thermal_zone_sysfs_remo static int acpi_thermal_register_thermal_zone(struct acpi_thermal *tz) { - int trips = 0; + int passive_delay = 0; + int trip_count = 0; int result; acpi_status status; int i; if (tz->trips.critical.valid) - trips++; + trip_count++; if (tz->trips.hot.valid) - trips++; - - if (tz->trips.passive.valid) - trips++; - - for (i = 0; i < ACPI_THERMAL_MAX_ACTIVE && tz->trips.active[i].valid; - i++, trips++); - - if (tz->trips.passive.valid) - tz->thermal_zone = thermal_zone_device_register("acpitz", trips, 0, tz, - &acpi_thermal_zone_ops, NULL, - tz->trips.passive.tsp * 100, - tz->polling_frequency * 100); - else - tz->thermal_zone = - thermal_zone_device_register("acpitz", trips, 0, tz, - &acpi_thermal_zone_ops, NULL, - 0, tz->polling_frequency * 100); + trip_count++; + if (tz->trips.passive.valid) { + trip_count++; + passive_delay = tz->trips.passive.tsp * 100; + } + + for (i = 0; i < ACPI_THERMAL_MAX_ACTIVE && tz->trips.active[i].valid; i++) + trip_count++; + + tz->thermal_zone = thermal_zone_device_register("acpitz", trip_count, 0, + tz, &acpi_thermal_zone_ops, + NULL, passive_delay, + tz->polling_frequency * 100); if (IS_ERR(tz->thermal_zone)) return -ENODEV; From patchwork Fri Jul 21 14:51:23 2023 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: "Rafael J. Wysocki" X-Patchwork-Id: 13322130 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from vger.kernel.org (vger.kernel.org [23.128.96.18]) by smtp.lore.kernel.org (Postfix) with ESMTP id 60272C04A94 for ; Fri, 21 Jul 2023 15:18:19 +0000 (UTC) Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S229536AbjGUPSR (ORCPT ); Fri, 21 Jul 2023 11:18:17 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:52964 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S231516AbjGUPSQ (ORCPT ); Fri, 21 Jul 2023 11:18:16 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id 9A18830DB; Fri, 21 Jul 2023 08:18:14 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.2.0) id 31b8b80791d346d9; Fri, 21 Jul 2023 17:18:13 +0200 Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id 9C449661901; Fri, 21 Jul 2023 17:18:12 +0200 (CEST) From: "Rafael J. Wysocki" To: Linux ACPI Cc: LKML , Linux PM , Michal Wilczynski , Zhang Rui , Srinivas Pandruvada , Daniel Lezcano Subject: [PATCH v2 5/8] ACPI: thermal: Hold thermal zone lock around trip updates Date: Fri, 21 Jul 2023 16:51:23 +0200 Message-ID: <3448044.QJadu78ljV@kreacher> In-Reply-To: <5710197.DvuYhMxLoT@kreacher> References: <13318886.uLZWGnKmhe@kreacher> <5710197.DvuYhMxLoT@kreacher> MIME-Version: 1.0 X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedviedrhedvgdekvdcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfjqffogffrnfdpggftiffpkfenuceurghilhhouhhtmecuudehtdenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhephffvvefufffkjghfggfgtgesthfuredttddtjeenucfhrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqeenucggtffrrghtthgvrhhnpedvffeuiedtgfdvtddugeeujedtffetteegfeekffdvfedttddtuefhgeefvdejhfenucfkphepudelhedrudefiedrudelrdelgeenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpeduleehrddufeeirdduledrleegpdhhvghlohepkhhrvggrtghhvghrrdhlohgtrghlnhgvthdpmhgrihhlfhhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqpdhnsggprhgtphhtthhopeejpdhrtghpthhtoheplhhinhhugidqrggtphhisehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqkhgvrhhnvghlsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqphhmsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtohepmhhitghhrghlrdifihhltgiihihnshhkihesihhnthgvlhdrtghomhdprhgt phhtthhopehruhhirdiihhgrnhhgsehinhhtvghlrdgtohhmpdhrtghpthhtohepshhrihhnihhvrghsrdhprghnughruhhvrggurgeslhhinhhugidrihhnthgvlhdrtghomh X-DCC--Metrics: v370.home.net.pl 1024; Body=7 Fuz1=7 Fuz2=7 Precedence: bulk List-ID: X-Mailing-List: linux-pm@vger.kernel.org From: Rafael J. Wysocki There is a race condition between acpi_thermal_trips_update() and acpi_thermal_check_fn(), because the trip points may get updated while the latter is running which in theory may lead to inconsistent results. For example, if two trips are updated together, using the temperature value of one of them from before the update and the temperature value of the other one from after the update may not lead to the expected outcome. To address this, make acpi_thermal_trips_update() hold the thermal zone lock across the entire update of trip points. While at it, change the acpi_thermal_trips_update() return data type to void as that function always returns 0 anyway. Signed-off-by: Rafael J. Wysocki --- v1 -> v2: * Hold the thermal zone lock instead of thermal_check_lock around trip point updates (this also helps to protect thermal_get_trend() from using stale trip temperatures). * Add a comment documenting the purpose of the locking. * Make acpi_thermal_trips_update() void. --- drivers/acpi/thermal.c | 21 ++++++++++++++++----- 1 file changed, 16 insertions(+), 5 deletions(-) Index: linux-pm/drivers/acpi/thermal.c =================================================================== --- linux-pm.orig/drivers/acpi/thermal.c +++ linux-pm/drivers/acpi/thermal.c @@ -190,7 +190,7 @@ static int acpi_thermal_get_polling_freq return 0; } -static int acpi_thermal_trips_update(struct acpi_thermal *tz, int flag) +static void __acpi_thermal_trips_update(struct acpi_thermal *tz, int flag) { acpi_status status; unsigned long long tmp; @@ -398,17 +398,28 @@ static int acpi_thermal_trips_update(str ACPI_THERMAL_TRIPS_EXCEPTION(flag, tz, "device"); } } +} - return 0; +static void acpi_thermal_trips_update(struct acpi_thermal *tz, int flag) +{ + /* + * The locking is needed here to protect thermal_get_trend() from using + * a stale passive trip temperature and to synchronize with the trip + * temperature updates in acpi_thermal_check_fn(). + */ + thermal_zone_device_lock(tz->thermal_zone); + + __acpi_thermal_trips_update(tz, flag); + + thermal_zone_device_unlock(tz->thermal_zone); } static int acpi_thermal_get_trip_points(struct acpi_thermal *tz) { - int i, ret = acpi_thermal_trips_update(tz, ACPI_TRIPS_INIT); bool valid; + int i; - if (ret) - return ret; + __acpi_thermal_trips_update(tz, ACPI_TRIPS_INIT); valid = tz->trips.critical.valid | tz->trips.hot.valid | From patchwork Fri Jul 21 15:00:57 2023 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: "Rafael J. Wysocki" X-Patchwork-Id: 13322129 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from vger.kernel.org (vger.kernel.org [23.128.96.18]) by smtp.lore.kernel.org (Postfix) with ESMTP id 22A58EB64DC for ; Fri, 21 Jul 2023 15:18:19 +0000 (UTC) Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S231768AbjGUPSQ (ORCPT ); Fri, 21 Jul 2023 11:18:16 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:52962 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S231432AbjGUPSP (ORCPT ); Fri, 21 Jul 2023 11:18:15 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id DAFB030DF; Fri, 21 Jul 2023 08:18:13 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.2.0) id 809219d3db5c0223; Fri, 21 Jul 2023 17:18:12 +0200 Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id DC9A3661901; Fri, 21 Jul 2023 17:18:11 +0200 (CEST) From: "Rafael J. Wysocki" To: Linux ACPI Cc: LKML , Linux PM , Michal Wilczynski , Zhang Rui , Srinivas Pandruvada , Daniel Lezcano Subject: [PATCH v2 6/8] ACPI: thermal: Use trip point table to register thermal zones Date: Fri, 21 Jul 2023 17:00:57 +0200 Message-ID: <4298510.ejJDZkT8p0@kreacher> In-Reply-To: <5710197.DvuYhMxLoT@kreacher> References: <13318886.uLZWGnKmhe@kreacher> <5710197.DvuYhMxLoT@kreacher> MIME-Version: 1.0 X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedviedrhedvgdekvdcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfjqffogffrnfdpggftiffpkfenuceurghilhhouhhtmecuudehtdenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhephffvvefufffkjghfggfgtgesthfuredttddtjeenucfhrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqeenucggtffrrghtthgvrhhnpedvffeuiedtgfdvtddugeeujedtffetteegfeekffdvfedttddtuefhgeefvdejhfenucfkphepudelhedrudefiedrudelrdelgeenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpeduleehrddufeeirdduledrleegpdhhvghlohepkhhrvggrtghhvghrrdhlohgtrghlnhgvthdpmhgrihhlfhhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqpdhnsggprhgtphhtthhopeejpdhrtghpthhtoheplhhinhhugidqrggtphhisehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqkhgvrhhnvghlsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqphhmsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtohepmhhitghhrghlrdifihhltgiihihnshhkihesihhnthgvlhdrtghomhdprhgt phhtthhopehruhhirdiihhgrnhhgsehinhhtvghlrdgtohhmpdhrtghpthhtohepshhrihhnihhvrghsrdhprghnughruhhvrggurgeslhhinhhugidrihhnthgvlhdrtghomh X-DCC--Metrics: v370.home.net.pl 1024; Body=7 Fuz1=7 Fuz2=7 Precedence: bulk List-ID: X-Mailing-List: linux-pm@vger.kernel.org From: Rafael J. Wysocki Make the ACPI thermal driver use thermal_zone_device_register_with_trips() to register its thermal zones. For this purpose, make it create a trip point table and pass it to thermal_zone_device_register_with_trips() as an argument and use the struct thermal_trip_ref introduced previously to connect the generic thermal trip structures to the internal data structures representing trip points in the driver. Signed-off-by: Rafael J. Wysocki --- drivers/acpi/thermal.c | 102 ++++++++++++++++++++++++++++++++++++++--- drivers/thermal/thermal_core.c | 1 include/linux/thermal.h | 2 3 files changed, 100 insertions(+), 5 deletions(-) Index: linux-pm/drivers/acpi/thermal.c =================================================================== --- linux-pm.orig/drivers/acpi/thermal.c +++ linux-pm/drivers/acpi/thermal.c @@ -97,16 +97,19 @@ MODULE_PARM_DESC(psv, "Disable or overri static struct workqueue_struct *acpi_thermal_pm_queue; struct acpi_thermal_critical { + struct thermal_trip_ref trip_ref; unsigned long temperature; bool valid; }; struct acpi_thermal_hot { + struct thermal_trip_ref trip_ref; unsigned long temperature; bool valid; }; struct acpi_thermal_passive { + struct thermal_trip_ref trip_ref; struct acpi_handle_list devices; unsigned long temperature; unsigned long tc1; @@ -116,6 +119,7 @@ struct acpi_thermal_passive { }; struct acpi_thermal_active { + struct thermal_trip_ref trip_ref; struct acpi_handle_list devices; unsigned long temperature; bool valid; @@ -137,6 +141,7 @@ struct acpi_thermal { unsigned long polling_frequency; volatile u8 zombie; struct acpi_thermal_trips trips; + struct thermal_trip *trip_table; struct acpi_handle_list devices; struct thermal_zone_device *thermal_zone; int kelvin_offset; /* in millidegrees */ @@ -190,6 +195,14 @@ static int acpi_thermal_get_polling_freq return 0; } +static void acpi_thermal_trip_update_temp(struct acpi_thermal *tz, + struct thermal_trip *trip, + long temperature) +{ + trip->temperature = deci_kelvin_to_millicelsius_with_offset(temperature, + tz->kelvin_offset); +} + static void __acpi_thermal_trips_update(struct acpi_thermal *tz, int flag) { acpi_status status; @@ -756,6 +769,7 @@ static void acpi_thermal_zone_sysfs_remo static int acpi_thermal_register_thermal_zone(struct acpi_thermal *tz) { + struct thermal_trip *trip; int passive_delay = 0; int trip_count = 0; int result; @@ -776,10 +790,52 @@ static int acpi_thermal_register_thermal for (i = 0; i < ACPI_THERMAL_MAX_ACTIVE && tz->trips.active[i].valid; i++) trip_count++; - tz->thermal_zone = thermal_zone_device_register("acpitz", trip_count, 0, - tz, &acpi_thermal_zone_ops, - NULL, passive_delay, - tz->polling_frequency * 100); + tz->trip_table = kcalloc(trip_count, sizeof(*tz->trip_table), GFP_KERNEL); + if (!tz->trip_table) + return -ENOMEM; + + trip = tz->trip_table; + + if (tz->trips.critical.valid) { + trip->type = THERMAL_TRIP_CRITICAL; + acpi_thermal_trip_update_temp(tz, trip, + tz->trips.critical.temperature); + trip->driver_ref = &tz->trips.critical.trip_ref; + trip++; + } + + if (tz->trips.hot.valid) { + trip->type = THERMAL_TRIP_HOT; + acpi_thermal_trip_update_temp(tz, trip, + tz->trips.hot.temperature); + trip->driver_ref = &tz->trips.hot.trip_ref; + trip++; + } + + if (tz->trips.passive.valid) { + trip->type = THERMAL_TRIP_PASSIVE; + acpi_thermal_trip_update_temp(tz, trip, + tz->trips.passive.temperature); + trip->driver_ref = &tz->trips.passive.trip_ref; + trip++; + } + + for (i = 0; i < ACPI_THERMAL_MAX_ACTIVE && tz->trips.active[i].valid; i++) { + trip->type = THERMAL_TRIP_ACTIVE; + acpi_thermal_trip_update_temp(tz, trip, + tz->trips.active[i].temperature); + trip->driver_ref = &tz->trips.active[i].trip_ref; + trip++; + } + + tz->thermal_zone = thermal_zone_device_register_with_trips("acpitz", + tz->trip_table, + trip_count, + 0, tz, + &acpi_thermal_zone_ops, + NULL, + passive_delay, + tz->polling_frequency * 100); if (IS_ERR(tz->thermal_zone)) return -ENODEV; @@ -817,6 +873,7 @@ static void acpi_thermal_unregister_ther { acpi_thermal_zone_sysfs_remove(tz); thermal_zone_device_unregister(tz->thermal_zone); + kfree(tz->trip_table); tz->thermal_zone = NULL; acpi_bus_detach_private_data(tz->device->handle); } @@ -950,6 +1007,9 @@ static void acpi_thermal_check_fn(struct { struct acpi_thermal *tz = container_of(work, struct acpi_thermal, thermal_check_work); + struct thermal_trip *trip; + long temperature; + int i; /* * In general, it is not sufficient to check the pending bit, because @@ -964,7 +1024,39 @@ static void acpi_thermal_check_fn(struct mutex_lock(&tz->thermal_check_lock); - thermal_zone_device_update(tz->thermal_zone, THERMAL_EVENT_UNSPECIFIED); + thermal_zone_device_lock(tz->thermal_zone); + + trip = tz->trips.passive.trip_ref.trip; + if (trip) { + /* + * This means that the passive trip was valid initially, so + * update its temperature in case it has changed or the trip + * has become invalid. + */ + temperature = tz->trips.passive.valid ? + tz->trips.passive.temperature : + THERMAL_TEMP_INVALID; + acpi_thermal_trip_update_temp(tz, trip, temperature); + } + + for (i = 0; i < ACPI_THERMAL_MAX_ACTIVE; i++) { + trip = tz->trips.active[i].trip_ref.trip; + if (trip) { + /* + * This means that the active trip #i was valid + * initially, so update its temperature in case it has + * changed or the trip has become invalid. + */ + temperature = tz->trips.active[i].valid ? + tz->trips.active[i].temperature : + THERMAL_TEMP_INVALID; + acpi_thermal_trip_update_temp(tz, trip, temperature); + } + } + + __thermal_zone_device_update(tz->thermal_zone, THERMAL_EVENT_UNSPECIFIED); + + thermal_zone_device_unlock(tz->thermal_zone); refcount_inc(&tz->thermal_check_count); Index: linux-pm/drivers/thermal/thermal_core.c =================================================================== --- linux-pm.orig/drivers/thermal/thermal_core.c +++ linux-pm/drivers/thermal/thermal_core.c @@ -429,6 +429,7 @@ void __thermal_zone_device_update(struct monitor_thermal_zone(tz); } +EXPORT_SYMBOL_GPL(__thermal_zone_device_update); static int thermal_zone_device_set_mode(struct thermal_zone_device *tz, enum thermal_device_mode mode) Index: linux-pm/include/linux/thermal.h =================================================================== --- linux-pm.orig/include/linux/thermal.h +++ linux-pm/include/linux/thermal.h @@ -334,6 +334,8 @@ int thermal_zone_bind_cooling_device(str unsigned int); int thermal_zone_unbind_cooling_device(struct thermal_zone_device *, int, struct thermal_cooling_device *); +void __thermal_zone_device_update(struct thermal_zone_device *, + enum thermal_notify_event); void thermal_zone_device_update(struct thermal_zone_device *, enum thermal_notify_event); void thermal_zone_device_lock(struct thermal_zone_device *tz); From patchwork Fri Jul 21 15:08:48 2023 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: "Rafael J. Wysocki" X-Patchwork-Id: 13322128 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from vger.kernel.org (vger.kernel.org [23.128.96.18]) by smtp.lore.kernel.org (Postfix) with ESMTP id 341FCC001DF for ; Fri, 21 Jul 2023 15:18:18 +0000 (UTC) Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S231683AbjGUPSQ (ORCPT ); Fri, 21 Jul 2023 11:18:16 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:52956 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S230041AbjGUPSP (ORCPT ); Fri, 21 Jul 2023 11:18:15 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id 2F35930DD; Fri, 21 Jul 2023 08:18:13 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.2.0) id 0a38bb1b8a5a6388; Fri, 21 Jul 2023 17:18:11 +0200 Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id 32225661901; Fri, 21 Jul 2023 17:18:11 +0200 (CEST) From: "Rafael J. Wysocki" To: Linux ACPI Cc: LKML , Linux PM , Michal Wilczynski , Zhang Rui , Srinivas Pandruvada , Daniel Lezcano Subject: [PATCH v2 7/8] ACPI: thermal: Rework thermal_get_trend() Date: Fri, 21 Jul 2023 17:08:48 +0200 Message-ID: <1849104.atdPhlSkOF@kreacher> In-Reply-To: <5710197.DvuYhMxLoT@kreacher> References: <13318886.uLZWGnKmhe@kreacher> <5710197.DvuYhMxLoT@kreacher> MIME-Version: 1.0 X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedviedrhedvgdekvdcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfjqffogffrnfdpggftiffpkfenuceurghilhhouhhtmecuudehtdenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhephffvvefufffkjghfggfgtgesthfuredttddtjeenucfhrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqeenucggtffrrghtthgvrhhnpedvffeuiedtgfdvtddugeeujedtffetteegfeekffdvfedttddtuefhgeefvdejhfenucfkphepudelhedrudefiedrudelrdelgeenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpeduleehrddufeeirdduledrleegpdhhvghlohepkhhrvggrtghhvghrrdhlohgtrghlnhgvthdpmhgrihhlfhhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqpdhnsggprhgtphhtthhopeejpdhrtghpthhtoheplhhinhhugidqrggtphhisehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqkhgvrhhnvghlsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqphhmsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtohepmhhitghhrghlrdifihhltgiihihnshhkihesihhnthgvlhdrtghomhdprhgt phhtthhopehruhhirdiihhgrnhhgsehinhhtvghlrdgtohhmpdhrtghpthhtohepshhrihhnihhvrghsrdhprghnughruhhvrggurgeslhhinhhugidrihhnthgvlhdrtghomh X-DCC--Metrics: v370.home.net.pl 1024; Body=7 Fuz1=7 Fuz2=7 Precedence: bulk List-ID: X-Mailing-List: linux-pm@vger.kernel.org From: Rafael J. Wysocki Rework the ACPI thermal driver's .get_trend() callback function, thermal_get_trend(), to use trip point data stored in the generic trip structures instead of calling thermal_get_trip_type() and thermal_get_trip_temp(). Signed-off-by: Rafael J. Wysocki --- v1 -> v2: * Do not acquire thermal_check_lock in thermal_get_trend() (lockdep would complain about this, because it is hold around thermal zone locking and .get_trend() runs under the thermal zone lock). The thermal zone locking added in the previous patches is sufficient to protect this code. * Check trips against invalid temperature values. * Return an error for trips other than passive and active. --- drivers/acpi/thermal.c | 106 ++++++++++++++++++++++++++++++++++++------------- 1 file changed, 78 insertions(+), 28 deletions(-) Index: linux-pm/drivers/acpi/thermal.c =================================================================== --- linux-pm.orig/drivers/acpi/thermal.c +++ linux-pm/drivers/acpi/thermal.c @@ -577,47 +577,97 @@ static int thermal_get_crit_temp(struct return -EINVAL; } -static int thermal_get_trend(struct thermal_zone_device *thermal, - int trip, enum thermal_trend *trend) +static struct thermal_trip *acpi_thermal_get_trip(struct acpi_thermal *tz, + int trip_index) { - struct acpi_thermal *tz = thermal_zone_device_priv(thermal); - enum thermal_trip_type type; + struct thermal_trip *trip; int i; - if (thermal_get_trip_type(thermal, trip, &type)) - return -EINVAL; + if (!tz || trip_index < 0) + return NULL; - if (type == THERMAL_TRIP_ACTIVE) { - int trip_temp; - int temp = deci_kelvin_to_millicelsius_with_offset( - tz->temperature, tz->kelvin_offset); - if (thermal_get_trip_temp(thermal, trip, &trip_temp)) - return -EINVAL; + trip = tz->trips.critical.trip_ref.trip; + if (trip) { + if (!trip_index) + return trip; - if (temp > trip_temp) { - *trend = THERMAL_TREND_RAISING; - return 0; - } else { - /* Fall back on default trend */ - return -EINVAL; + trip_index--; + } + + trip = tz->trips.hot.trip_ref.trip; + if (trip) { + if (!trip_index) + return trip; + + trip_index--; + } + + trip = tz->trips.passive.trip_ref.trip; + if (trip) { + if (!trip_index) + return trip; + + trip_index--; + } + + for (i = 0; i < ACPI_THERMAL_MAX_ACTIVE; i++) { + trip = tz->trips.active[i].trip_ref.trip; + if (trip) { + if (!trip_index) + return trip; + + trip_index--; } } + return NULL; +} + +static int thermal_get_trend(struct thermal_zone_device *thermal, + int trip_index, enum thermal_trend *trend) +{ + struct acpi_thermal *tz = thermal_zone_device_priv(thermal); + struct thermal_trip *trip; + long t; + + trip = acpi_thermal_get_trip(tz, trip_index); + if (!trip || trip->temperature == THERMAL_TEMP_INVALID) + return -EINVAL; + /* * tz->temperature has already been updated by generic thermal layer, - * before this callback being invoked + * before this callback being invoked. */ - i = tz->trips.passive.tc1 * (tz->temperature - tz->last_temperature) + - tz->trips.passive.tc2 * (tz->temperature - tz->trips.passive.temperature); + switch (trip->type) { + case THERMAL_TRIP_PASSIVE: + t = tz->trips.passive.tc1 * (tz->temperature - + tz->last_temperature) + + tz->trips.passive.tc2 * (tz->temperature - + tz->trips.passive.temperature); + if (t > 0) + *trend = THERMAL_TREND_RAISING; + else if (t < 0) + *trend = THERMAL_TREND_DROPPING; + else + *trend = THERMAL_TREND_STABLE; + + return 0; + + case THERMAL_TRIP_ACTIVE: + t = deci_kelvin_to_millicelsius_with_offset(tz->temperature, + tz->kelvin_offset); + if (t > trip->temperature) { + *trend = THERMAL_TREND_RAISING; + return 0; + } - if (i > 0) - *trend = THERMAL_TREND_RAISING; - else if (i < 0) - *trend = THERMAL_TREND_DROPPING; - else - *trend = THERMAL_TREND_STABLE; + fallthrough; - return 0; + default: + break; + } + + return -EINVAL; } static void acpi_thermal_zone_device_hot(struct thermal_zone_device *thermal) From patchwork Fri Jul 21 15:10:34 2023 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: "Rafael J. Wysocki" X-Patchwork-Id: 13322127 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from vger.kernel.org (vger.kernel.org [23.128.96.18]) by smtp.lore.kernel.org (Postfix) with ESMTP id 4BB20C001DC for ; Fri, 21 Jul 2023 15:18:16 +0000 (UTC) Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S230345AbjGUPSP (ORCPT ); Fri, 21 Jul 2023 11:18:15 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:52950 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S229536AbjGUPSO (ORCPT ); Fri, 21 Jul 2023 11:18:14 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id CA17B30DB; Fri, 21 Jul 2023 08:18:12 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.2.0) id eb916d3108774ad8; Fri, 21 Jul 2023 17:18:10 +0200 Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id 703C6661901; Fri, 21 Jul 2023 17:18:10 +0200 (CEST) From: "Rafael J. Wysocki" To: Linux ACPI Cc: LKML , Linux PM , Michal Wilczynski , Zhang Rui , Srinivas Pandruvada , Daniel Lezcano Subject: [PATCH v2 8/8] ACPI: thermal: Drop unnecessary thermal zone callbacks Date: Fri, 21 Jul 2023 17:10:34 +0200 Message-ID: <2178456.Icojqenx9y@kreacher> In-Reply-To: <5710197.DvuYhMxLoT@kreacher> References: <13318886.uLZWGnKmhe@kreacher> <5710197.DvuYhMxLoT@kreacher> MIME-Version: 1.0 X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedviedrhedvgdekvdcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfjqffogffrnfdpggftiffpkfenuceurghilhhouhhtmecuudehtdenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhephffvvefufffkjghfggfgtgesthfuredttddtjeenucfhrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqeenucggtffrrghtthgvrhhnpedvffeuiedtgfdvtddugeeujedtffetteegfeekffdvfedttddtuefhgeefvdejhfenucfkphepudelhedrudefiedrudelrdelgeenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpeduleehrddufeeirdduledrleegpdhhvghlohepkhhrvggrtghhvghrrdhlohgtrghlnhgvthdpmhgrihhlfhhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqpdhnsggprhgtphhtthhopeejpdhrtghpthhtoheplhhinhhugidqrggtphhisehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqkhgvrhhnvghlsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqphhmsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtohepmhhitghhrghlrdifihhltgiihihnshhkihesihhnthgvlhdrtghomhdprhgt phhtthhopehruhhirdiihhgrnhhgsehinhhtvghlrdgtohhmpdhrtghpthhtohepshhrihhnihhvrghsrdhprghnughruhhvrggurgeslhhinhhugidrihhnthgvlhdrtghomh X-DCC--Metrics: v370.home.net.pl 1024; Body=7 Fuz1=7 Fuz2=7 Precedence: bulk List-ID: X-Mailing-List: linux-pm@vger.kernel.org From: Rafael J. Wysocki Drop the .get_trip_type(), .get_trip_temp() and .get_crit_temp() thermal zone callbacks that are not necessary any more from the ACPI thermal driver along with the corresponding callback functions. Signed-off-by: Rafael J. Wysocki --- drivers/acpi/thermal.c | 115 ------------------------------------------------- 1 file changed, 115 deletions(-) Index: linux-pm/drivers/acpi/thermal.c =================================================================== --- linux-pm.orig/drivers/acpi/thermal.c +++ linux-pm/drivers/acpi/thermal.c @@ -465,118 +465,6 @@ static int thermal_get_temp(struct therm return 0; } -static int thermal_get_trip_type(struct thermal_zone_device *thermal, - int trip, enum thermal_trip_type *type) -{ - struct acpi_thermal *tz = thermal_zone_device_priv(thermal); - int i; - - if (!tz || trip < 0) - return -EINVAL; - - if (tz->trips.critical.valid) { - if (!trip) { - *type = THERMAL_TRIP_CRITICAL; - return 0; - } - trip--; - } - - if (tz->trips.hot.valid) { - if (!trip) { - *type = THERMAL_TRIP_HOT; - return 0; - } - trip--; - } - - if (tz->trips.passive.valid) { - if (!trip) { - *type = THERMAL_TRIP_PASSIVE; - return 0; - } - trip--; - } - - for (i = 0; i < ACPI_THERMAL_MAX_ACTIVE && tz->trips.active[i].valid; i++) { - if (!trip) { - *type = THERMAL_TRIP_ACTIVE; - return 0; - } - trip--; - } - - return -EINVAL; -} - -static int thermal_get_trip_temp(struct thermal_zone_device *thermal, - int trip, int *temp) -{ - struct acpi_thermal *tz = thermal_zone_device_priv(thermal); - int i; - - if (!tz || trip < 0) - return -EINVAL; - - if (tz->trips.critical.valid) { - if (!trip) { - *temp = deci_kelvin_to_millicelsius_with_offset( - tz->trips.critical.temperature, - tz->kelvin_offset); - return 0; - } - trip--; - } - - if (tz->trips.hot.valid) { - if (!trip) { - *temp = deci_kelvin_to_millicelsius_with_offset( - tz->trips.hot.temperature, - tz->kelvin_offset); - return 0; - } - trip--; - } - - if (tz->trips.passive.valid) { - if (!trip) { - *temp = deci_kelvin_to_millicelsius_with_offset( - tz->trips.passive.temperature, - tz->kelvin_offset); - return 0; - } - trip--; - } - - for (i = 0; i < ACPI_THERMAL_MAX_ACTIVE && - tz->trips.active[i].valid; i++) { - if (!trip) { - *temp = deci_kelvin_to_millicelsius_with_offset( - tz->trips.active[i].temperature, - tz->kelvin_offset); - return 0; - } - trip--; - } - - return -EINVAL; -} - -static int thermal_get_crit_temp(struct thermal_zone_device *thermal, - int *temperature) -{ - struct acpi_thermal *tz = thermal_zone_device_priv(thermal); - - if (tz->trips.critical.valid) { - *temperature = deci_kelvin_to_millicelsius_with_offset( - tz->trips.critical.temperature, - tz->kelvin_offset); - return 0; - } - - return -EINVAL; -} - static struct thermal_trip *acpi_thermal_get_trip(struct acpi_thermal *tz, int trip_index) { @@ -781,9 +669,6 @@ static struct thermal_zone_device_ops ac .bind = acpi_thermal_bind_cooling_device, .unbind = acpi_thermal_unbind_cooling_device, .get_temp = thermal_get_temp, - .get_trip_type = thermal_get_trip_type, - .get_trip_temp = thermal_get_trip_temp, - .get_crit_temp = thermal_get_crit_temp, .get_trend = thermal_get_trend, .hot = acpi_thermal_zone_device_hot, .critical = acpi_thermal_zone_device_critical,