From patchwork Tue Sep 12 18:35:40 2023 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: "Rafael J. Wysocki" X-Patchwork-Id: 13382065 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from vger.kernel.org (vger.kernel.org [23.128.96.18]) by smtp.lore.kernel.org (Postfix) with ESMTP id 8545DEE3F0B for ; Tue, 12 Sep 2023 18:48:13 +0000 (UTC) Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S237602AbjILSsQ (ORCPT ); Tue, 12 Sep 2023 14:48:16 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:41264 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S237610AbjILSry (ORCPT ); Tue, 12 Sep 2023 14:47:54 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id C988A1725; Tue, 12 Sep 2023 11:47:46 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.2.0) id cd625864ca82de2a; Tue, 12 Sep 2023 20:47:45 +0200 Authentication-Results: v370.home.net.pl; spf=softfail (domain owner discourages use of this host) smtp.mailfrom=rjwysocki.net (client-ip=195.136.19.94; helo=[195.136.19.94]; envelope-from=rjw@rjwysocki.net; receiver=) Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id C09AD663BE5; Tue, 12 Sep 2023 20:47:44 +0200 (CEST) From: "Rafael J. Wysocki" To: Linux ACPI Cc: LKML , Linux PM , Zhang Rui , Srinivas Pandruvada , Daniel Lezcano Subject: [PATCH v1 1/9] ACPI: thermal: Simplify initialization of critical and hot trips Date: Tue, 12 Sep 2023 20:35:40 +0200 Message-ID: <4858652.31r3eYUQgx@kreacher> In-Reply-To: <5708760.DvuYhMxLoT@kreacher> References: <5708760.DvuYhMxLoT@kreacher> MIME-Version: 1.0 X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedviedrudeiiedgudeftdcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfjqffogffrnfdpggftiffpkfenuceurghilhhouhhtmecuudehtdenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhephffvvefufffkjghfggfgtgesthfuredttddtjeenucfhrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqeenucggtffrrghtthgvrhhnpedvffeuiedtgfdvtddugeeujedtffetteegfeekffdvfedttddtuefhgeefvdejhfenucfkphepudelhedrudefiedrudelrdelgeenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpeduleehrddufeeirdduledrleegpdhhvghlohepkhhrvggrtghhvghrrdhlohgtrghlnhgvthdpmhgrihhlfhhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqpdhnsggprhgtphhtthhopeeipdhrtghpthhtoheplhhinhhugidqrggtphhisehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqkhgvrhhnvghlsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqphhmsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheprhhuihdriihhrghnghesihhnthgvlhdrtghomhdprhgtphhtthhopehs rhhinhhivhgrshdrphgrnhgurhhuvhgruggrsehlihhnuhigrdhinhhtvghlrdgtohhmpdhrtghpthhtohepuggrnhhivghlrdhlvgiitggrnhhosehlihhnrghrohdrohhrgh X-DCC--Metrics: v370.home.net.pl 1024; Body=6 Fuz1=6 Fuz2=6 Precedence: bulk List-ID: X-Mailing-List: linux-acpi@vger.kernel.org From: Rafael J. Wysocki Use the observation that the critical and hot trip points are never updated by the ACPI thermal driver, because the flags passed from acpi_thermal_notify() to acpi_thermal_trips_update() do not include ACPI_TRIPS_CRITICAL or ACPI_TRIPS_HOT, to move the initialization of those trip points directly into acpi_thermal_get_trip_points() and reduce the size of __acpi_thermal_trips_update(). Also make the critical and hot trip points initialization code more straightforward and drop the flags that are not needed any more. Signed-off-by: Rafael J. Wysocki Reviewed-by: Daniel Lezcano --- drivers/acpi/thermal.c | 130 ++++++++++++++++++++++++------------------------- 1 file changed, 66 insertions(+), 64 deletions(-) Index: linux-pm/drivers/acpi/thermal.c =================================================================== --- linux-pm.orig/drivers/acpi/thermal.c +++ linux-pm/drivers/acpi/thermal.c @@ -43,17 +43,13 @@ #define ACPI_THERMAL_MAX_ACTIVE 10 #define ACPI_THERMAL_MAX_LIMIT_STR_LEN 65 -#define ACPI_TRIPS_CRITICAL BIT(0) -#define ACPI_TRIPS_HOT BIT(1) -#define ACPI_TRIPS_PASSIVE BIT(2) -#define ACPI_TRIPS_ACTIVE BIT(3) -#define ACPI_TRIPS_DEVICES BIT(4) +#define ACPI_TRIPS_PASSIVE BIT(0) +#define ACPI_TRIPS_ACTIVE BIT(1) +#define ACPI_TRIPS_DEVICES BIT(2) #define ACPI_TRIPS_THRESHOLDS (ACPI_TRIPS_PASSIVE | ACPI_TRIPS_ACTIVE) -#define ACPI_TRIPS_INIT (ACPI_TRIPS_CRITICAL | ACPI_TRIPS_HOT | \ - ACPI_TRIPS_PASSIVE | ACPI_TRIPS_ACTIVE | \ - ACPI_TRIPS_DEVICES) +#define ACPI_TRIPS_INIT (ACPI_TRIPS_THRESHOLDS | ACPI_TRIPS_DEVICES) /* * This exception is thrown out in two cases: @@ -196,62 +192,6 @@ static void __acpi_thermal_trips_update( bool valid = false; int i; - /* Critical Shutdown */ - if (flag & ACPI_TRIPS_CRITICAL) { - status = acpi_evaluate_integer(tz->device->handle, "_CRT", NULL, &tmp); - tz->trips.critical.temperature = tmp; - /* - * Treat freezing temperatures as invalid as well; some - * BIOSes return really low values and cause reboots at startup. - * Below zero (Celsius) values clearly aren't right for sure.. - * ... so lets discard those as invalid. - */ - if (ACPI_FAILURE(status)) { - tz->trips.critical.valid = false; - acpi_handle_debug(tz->device->handle, - "No critical threshold\n"); - } else if (tmp <= 2732) { - pr_info(FW_BUG "Invalid critical threshold (%llu)\n", tmp); - tz->trips.critical.valid = false; - } else { - tz->trips.critical.valid = true; - acpi_handle_debug(tz->device->handle, - "Found critical threshold [%lu]\n", - tz->trips.critical.temperature); - } - if (tz->trips.critical.valid) { - if (crt == -1) { - tz->trips.critical.valid = false; - } else if (crt > 0) { - unsigned long crt_k = celsius_to_deci_kelvin(crt); - - /* - * Allow override critical threshold - */ - if (crt_k > tz->trips.critical.temperature) - pr_info("Critical threshold %d C\n", crt); - - tz->trips.critical.temperature = crt_k; - } - } - } - - /* Critical Sleep (optional) */ - if (flag & ACPI_TRIPS_HOT) { - status = acpi_evaluate_integer(tz->device->handle, "_HOT", NULL, &tmp); - if (ACPI_FAILURE(status)) { - tz->trips.hot.valid = false; - acpi_handle_debug(tz->device->handle, - "No hot threshold\n"); - } else { - tz->trips.hot.temperature = tmp; - tz->trips.hot.valid = true; - acpi_handle_debug(tz->device->handle, - "Found hot threshold [%lu]\n", - tz->trips.hot.temperature); - } - } - /* Passive (optional) */ if (((flag & ACPI_TRIPS_PASSIVE) && tz->trips.passive.trip.valid) || flag == ACPI_TRIPS_INIT) { @@ -451,11 +391,73 @@ static void acpi_thermal_trips_update(st dev_name(&adev->dev), event, 0); } +static void acpi_thermal_get_critical_trip(struct acpi_thermal *tz) +{ + unsigned long long tmp; + acpi_status status; + + if (crt > 0) { + tmp = celsius_to_deci_kelvin(crt); + goto set; + } + if (crt == -1) { + acpi_handle_debug(tz->device->handle, "Critical threshold disabled\n"); + goto fail; + } + + status = acpi_evaluate_integer(tz->device->handle, "_CRT", NULL, &tmp); + if (ACPI_FAILURE(status)) { + acpi_handle_debug(tz->device->handle, "No critical threshold\n"); + goto fail; + } + if (tmp <= 2732) { + /* + * Below zero (Celsius) values clearly aren't right for sure, + * so discard them as invalid. + */ + pr_info(FW_BUG "Invalid critical threshold (%llu)\n", tmp); + goto fail; + } + +set: + tz->trips.critical.valid = true; + tz->trips.critical.temperature = tmp; + acpi_handle_debug(tz->device->handle, "Critical threshold [%lu]\n", + tz->trips.critical.temperature); + return; + +fail: + tz->trips.critical.valid = false; + tz->trips.critical.temperature = THERMAL_TEMP_INVALID; +} + +static void acpi_thermal_get_hot_trip(struct acpi_thermal *tz) +{ + unsigned long long tmp; + acpi_status status; + + status = acpi_evaluate_integer(tz->device->handle, "_HOT", NULL, &tmp); + if (ACPI_FAILURE(status)) { + tz->trips.hot.valid = false; + tz->trips.hot.temperature = THERMAL_TEMP_INVALID; + acpi_handle_debug(tz->device->handle, "No hot threshold\n"); + return; + } + + tz->trips.hot.valid = true; + tz->trips.hot.temperature = tmp; + acpi_handle_debug(tz->device->handle, "Hot threshold [%lu]\n", + tz->trips.hot.temperature); +} + static int acpi_thermal_get_trip_points(struct acpi_thermal *tz) { bool valid; int i; + acpi_thermal_get_critical_trip(tz); + acpi_thermal_get_hot_trip(tz); + /* Passive and active trip points (optional). */ __acpi_thermal_trips_update(tz, ACPI_TRIPS_INIT); valid = tz->trips.critical.valid | From patchwork Tue Sep 12 18:36:21 2023 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: "Rafael J. Wysocki" X-Patchwork-Id: 13382064 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from vger.kernel.org (vger.kernel.org [23.128.96.18]) by smtp.lore.kernel.org (Postfix) with ESMTP id 0222DEE3F0D for ; Tue, 12 Sep 2023 18:48:00 +0000 (UTC) Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S237690AbjILSsD (ORCPT ); Tue, 12 Sep 2023 14:48:03 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:41250 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S237606AbjILSry (ORCPT ); Tue, 12 Sep 2023 14:47:54 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id B23751722; Tue, 12 Sep 2023 11:47:45 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.2.0) id d5ab5436fc065d13; Tue, 12 Sep 2023 20:47:44 +0200 Authentication-Results: v370.home.net.pl; spf=softfail (domain owner discourages use of this host) smtp.mailfrom=rjwysocki.net (client-ip=195.136.19.94; helo=[195.136.19.94]; envelope-from=rjw@rjwysocki.net; receiver=) Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id AAB59663BE5; Tue, 12 Sep 2023 20:47:43 +0200 (CEST) From: "Rafael J. Wysocki" To: Linux ACPI Cc: LKML , Linux PM , Zhang Rui , Srinivas Pandruvada , Daniel Lezcano Subject: [PATCH v1 2/9] ACPI: thermal: Fold acpi_thermal_get_info() into its caller Date: Tue, 12 Sep 2023 20:36:21 +0200 Message-ID: <2296248.ElGaqSPkdT@kreacher> In-Reply-To: <5708760.DvuYhMxLoT@kreacher> References: <5708760.DvuYhMxLoT@kreacher> MIME-Version: 1.0 X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedviedrudeiiedgudeftdcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfjqffogffrnfdpggftiffpkfenuceurghilhhouhhtmecuudehtdenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhephffvvefufffkjghfggfgtgesthfuredttddtjeenucfhrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqeenucggtffrrghtthgvrhhnpedvffeuiedtgfdvtddugeeujedtffetteegfeekffdvfedttddtuefhgeefvdejhfenucfkphepudelhedrudefiedrudelrdelgeenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpeduleehrddufeeirdduledrleegpdhhvghlohepkhhrvggrtghhvghrrdhlohgtrghlnhgvthdpmhgrihhlfhhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqpdhnsggprhgtphhtthhopeeipdhrtghpthhtoheplhhinhhugidqrggtphhisehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqkhgvrhhnvghlsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqphhmsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheprhhuihdriihhrghnghesihhnthgvlhdrtghomhdprhgtphhtthhopehs rhhinhhivhgrshdrphgrnhgurhhuvhgruggrsehlihhnuhigrdhinhhtvghlrdgtohhmpdhrtghpthhtohepuggrnhhivghlrdhlvgiitggrnhhosehlihhnrghrohdrohhrgh X-DCC--Metrics: v370.home.net.pl 1024; Body=6 Fuz1=6 Fuz2=6 Precedence: bulk List-ID: X-Mailing-List: linux-acpi@vger.kernel.org From: Rafael J. Wysocki There is only one caller of acpi_thermal_get_info() and the code from it can be folded into its caller just fine, so do that. No intentional functional impact. Signed-off-by: Rafael J. Wysocki Reviewed-by: Daniel Lezcano --- drivers/acpi/thermal.c | 52 +++++++++++++++++-------------------------------- 1 file changed, 19 insertions(+), 33 deletions(-) Index: linux-pm/drivers/acpi/thermal.c =================================================================== --- linux-pm.orig/drivers/acpi/thermal.c +++ linux-pm/drivers/acpi/thermal.c @@ -846,38 +846,6 @@ static void acpi_thermal_aml_dependency_ acpi_evaluate_integer(handle, "_TMP", NULL, &value); } -static int acpi_thermal_get_info(struct acpi_thermal *tz) -{ - int result; - - if (!tz) - return -EINVAL; - - acpi_thermal_aml_dependency_fix(tz); - - /* Get trip points [_CRT, _PSV, etc.] (required) */ - result = acpi_thermal_get_trip_points(tz); - if (result) - return result; - - /* Get temperature [_TMP] (required) */ - result = acpi_thermal_get_temperature(tz); - if (result) - return result; - - /* Set the cooling mode [_SCP] to active cooling (default) */ - acpi_execute_simple_method(tz->device->handle, "_SCP", - ACPI_THERMAL_MODE_ACTIVE); - - /* Get default polling frequency [_TZP] (optional) */ - if (tzp) - tz->polling_frequency = tzp; - else - acpi_thermal_get_polling_frequency(tz); - - return 0; -} - /* * The exact offset between Kelvin and degree Celsius is 273.15. However ACPI * handles temperature values with a single decimal place. As a consequence, @@ -940,10 +908,28 @@ static int acpi_thermal_add(struct acpi_ strcpy(acpi_device_class(device), ACPI_THERMAL_CLASS); device->driver_data = tz; - result = acpi_thermal_get_info(tz); + acpi_thermal_aml_dependency_fix(tz); + + /* Get trip points [_CRT, _PSV, etc.] (required). */ + result = acpi_thermal_get_trip_points(tz); if (result) goto free_memory; + /* Get temperature [_TMP] (required). */ + result = acpi_thermal_get_temperature(tz); + if (result) + goto free_memory; + + /* Set the cooling mode [_SCP] to active cooling. */ + acpi_execute_simple_method(tz->device->handle, "_SCP", + ACPI_THERMAL_MODE_ACTIVE); + + /* Determine the default polling frequency [_TZP]. */ + if (tzp) + tz->polling_frequency = tzp; + else + acpi_thermal_get_polling_frequency(tz); + acpi_thermal_guess_offset(tz); result = acpi_thermal_register_thermal_zone(tz); From patchwork Tue Sep 12 18:37:59 2023 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: "Rafael J. Wysocki" X-Patchwork-Id: 13382063 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from vger.kernel.org (vger.kernel.org [23.128.96.18]) by smtp.lore.kernel.org (Postfix) with ESMTP id EC92AEE3F12 for ; Tue, 12 Sep 2023 18:47:54 +0000 (UTC) Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S237591AbjILSr5 (ORCPT ); Tue, 12 Sep 2023 14:47:57 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:41220 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S237590AbjILSry (ORCPT ); Tue, 12 Sep 2023 14:47:54 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id DD9C21716; Tue, 12 Sep 2023 11:47:43 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.2.0) id 1f78031281b7904c; Tue, 12 Sep 2023 20:47:42 +0200 Authentication-Results: v370.home.net.pl; spf=softfail (domain owner discourages use of this host) smtp.mailfrom=rjwysocki.net (client-ip=195.136.19.94; helo=[195.136.19.94]; envelope-from=rjw@rjwysocki.net; receiver=) Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id E0F5A663BE5; Tue, 12 Sep 2023 20:47:41 +0200 (CEST) From: "Rafael J. Wysocki" To: Linux ACPI Cc: LKML , Linux PM , Zhang Rui , Srinivas Pandruvada , Daniel Lezcano Subject: [PATCH v1 3/9] ACPI: thermal: Determine the number of trip points earlier Date: Tue, 12 Sep 2023 20:37:59 +0200 Message-ID: <1863318.tdWV9SEqCh@kreacher> In-Reply-To: <5708760.DvuYhMxLoT@kreacher> References: <5708760.DvuYhMxLoT@kreacher> MIME-Version: 1.0 X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedviedrudeiiedgudeftdcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfjqffogffrnfdpggftiffpkfenuceurghilhhouhhtmecuudehtdenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhephffvvefufffkjghfggfgtgesthfuredttddtjeenucfhrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqeenucggtffrrghtthgvrhhnpedvffeuiedtgfdvtddugeeujedtffetteegfeekffdvfedttddtuefhgeefvdejhfenucfkphepudelhedrudefiedrudelrdelgeenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpeduleehrddufeeirdduledrleegpdhhvghlohepkhhrvggrtghhvghrrdhlohgtrghlnhgvthdpmhgrihhlfhhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqpdhnsggprhgtphhtthhopeeipdhrtghpthhtoheplhhinhhugidqrggtphhisehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqkhgvrhhnvghlsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqphhmsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheprhhuihdriihhrghnghesihhnthgvlhdrtghomhdprhgtphhtthhopehs rhhinhhivhgrshdrphgrnhgurhhuvhgruggrsehlihhnuhigrdhinhhtvghlrdgtohhmpdhrtghpthhtohepuggrnhhivghlrdhlvgiitggrnhhosehlihhnrghrohdrohhrgh X-DCC--Metrics: v370.home.net.pl 1024; Body=6 Fuz1=6 Fuz2=6 Precedence: bulk List-ID: X-Mailing-List: linux-acpi@vger.kernel.org From: Rafael J. Wysocki Compute the number of trip points in acpi_thermal_add() so as to allow the driver's data structures to be simplified going forward. No intentional functional impact. Signed-off-by: Rafael J. Wysocki Reviewed-by: Daniel Lezcano --- drivers/acpi/thermal.c | 60 +++++++++++++++++++++++-------------------------- 1 file changed, 29 insertions(+), 31 deletions(-) Index: linux-pm/drivers/acpi/thermal.c =================================================================== --- linux-pm.orig/drivers/acpi/thermal.c +++ linux-pm/drivers/acpi/thermal.c @@ -452,7 +452,7 @@ static void acpi_thermal_get_hot_trip(st static int acpi_thermal_get_trip_points(struct acpi_thermal *tz) { - bool valid; + unsigned int count = 0; int i; acpi_thermal_get_critical_trip(tz); @@ -460,18 +460,24 @@ static int acpi_thermal_get_trip_points( /* Passive and active trip points (optional). */ __acpi_thermal_trips_update(tz, ACPI_TRIPS_INIT); - valid = tz->trips.critical.valid | - tz->trips.hot.valid | - tz->trips.passive.trip.valid; - - for (i = 0; i < ACPI_THERMAL_MAX_ACTIVE; i++) - valid = valid || tz->trips.active[i].trip.valid; - - if (!valid) { - pr_warn(FW_BUG "No valid trip found\n"); - return -ENODEV; + if (tz->trips.critical.valid) + count++; + + if (tz->trips.hot.valid) + count++; + + if (tz->trips.passive.trip.valid) + count++; + + for (i = 0; i < ACPI_THERMAL_MAX_ACTIVE; i++) { + if (tz->trips.active[i].trip.valid) + count++; + else + break; + } - return 0; + + return count; } /* sys I/F for generic thermal sysfs support */ @@ -681,29 +687,15 @@ static void acpi_thermal_zone_sysfs_remo sysfs_remove_link(&tzdev->kobj, "device"); } -static int acpi_thermal_register_thermal_zone(struct acpi_thermal *tz) +static int acpi_thermal_register_thermal_zone(struct acpi_thermal *tz, + unsigned int trip_count) { struct acpi_thermal_trip *acpi_trip; struct thermal_trip *trip; int passive_delay = 0; - int trip_count = 0; int result; int i; - if (tz->trips.critical.valid) - trip_count++; - - if (tz->trips.hot.valid) - trip_count++; - - if (tz->trips.passive.trip.valid) { - trip_count++; - passive_delay = tz->trips.passive.tsp * 100; - } - - for (i = 0; i < ACPI_THERMAL_MAX_ACTIVE && tz->trips.active[i].trip.valid; i++) - trip_count++; - trip = kcalloc(trip_count, sizeof(*trip), GFP_KERNEL); if (!trip) return -ENOMEM; @@ -724,6 +716,8 @@ static int acpi_thermal_register_thermal acpi_trip = &tz->trips.passive.trip; if (acpi_trip->valid) { + passive_delay = tz->trips.passive.tsp * 100; + trip->type = THERMAL_TRIP_PASSIVE; trip->temperature = acpi_thermal_temp(tz, acpi_trip->temperature); trip->priv = acpi_trip; @@ -893,6 +887,7 @@ static void acpi_thermal_check_fn(struct static int acpi_thermal_add(struct acpi_device *device) { struct acpi_thermal *tz; + unsigned int trip_count; int result; if (!device) @@ -911,9 +906,12 @@ static int acpi_thermal_add(struct acpi_ acpi_thermal_aml_dependency_fix(tz); /* Get trip points [_CRT, _PSV, etc.] (required). */ - result = acpi_thermal_get_trip_points(tz); - if (result) + trip_count = acpi_thermal_get_trip_points(tz); + if (!trip_count) { + pr_warn(FW_BUG "No valid trip points!\n"); + result = -ENODEV; goto free_memory; + } /* Get temperature [_TMP] (required). */ result = acpi_thermal_get_temperature(tz); @@ -932,7 +930,7 @@ static int acpi_thermal_add(struct acpi_ acpi_thermal_guess_offset(tz); - result = acpi_thermal_register_thermal_zone(tz); + result = acpi_thermal_register_thermal_zone(tz, trip_count); if (result) goto free_memory; From patchwork Tue Sep 12 18:39:15 2023 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: "Rafael J. Wysocki" X-Patchwork-Id: 13382061 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from vger.kernel.org (vger.kernel.org [23.128.96.18]) by smtp.lore.kernel.org (Postfix) with ESMTP id 5E6DAEE3F0E for ; Tue, 12 Sep 2023 18:47:53 +0000 (UTC) Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S237586AbjILSr4 (ORCPT ); Tue, 12 Sep 2023 14:47:56 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:46458 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S237545AbjILSry (ORCPT ); Tue, 12 Sep 2023 14:47:54 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id 0D64E1705; Tue, 12 Sep 2023 11:47:41 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.2.0) id 25b387b3422685a1; Tue, 12 Sep 2023 20:47:40 +0200 Authentication-Results: v370.home.net.pl; spf=softfail (domain owner discourages use of this host) smtp.mailfrom=rjwysocki.net (client-ip=195.136.19.94; helo=[195.136.19.94]; envelope-from=rjw@rjwysocki.net; receiver=) Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id CE019663BE5; Tue, 12 Sep 2023 20:47:39 +0200 (CEST) From: "Rafael J. Wysocki" To: Linux ACPI Cc: LKML , Linux PM , Zhang Rui , Srinivas Pandruvada , Daniel Lezcano Subject: [PATCH v1 4/9] ACPI: thermal: Create and populate trip points table earlier Date: Tue, 12 Sep 2023 20:39:15 +0200 Message-ID: <13346091.uLZWGnKmhe@kreacher> In-Reply-To: <5708760.DvuYhMxLoT@kreacher> References: <5708760.DvuYhMxLoT@kreacher> MIME-Version: 1.0 X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedviedrudeiiedgudefudcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfjqffogffrnfdpggftiffpkfenuceurghilhhouhhtmecuudehtdenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhephffvvefufffkjghfggfgtgesthfuredttddtjeenucfhrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqeenucggtffrrghtthgvrhhnpedvffeuiedtgfdvtddugeeujedtffetteegfeekffdvfedttddtuefhgeefvdejhfenucfkphepudelhedrudefiedrudelrdelgeenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpeduleehrddufeeirdduledrleegpdhhvghlohepkhhrvggrtghhvghrrdhlohgtrghlnhgvthdpmhgrihhlfhhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqpdhnsggprhgtphhtthhopeeipdhrtghpthhtoheplhhinhhugidqrggtphhisehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqkhgvrhhnvghlsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqphhmsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheprhhuihdriihhrghnghesihhnthgvlhdrtghomhdprhgtphhtthhopehs rhhinhhivhgrshdrphgrnhgurhhuvhgruggrsehlihhnuhigrdhinhhtvghlrdgtohhmpdhrtghpthhtohepuggrnhhivghlrdhlvgiitggrnhhosehlihhnrghrohdrohhrgh X-DCC--Metrics: v370.home.net.pl 1024; Body=6 Fuz1=6 Fuz2=6 Precedence: bulk List-ID: X-Mailing-List: linux-acpi@vger.kernel.org From: Rafael J. Wysocki Create and populate the driver's trip points table in acpi_thermal_add() so as to allow the its data structures to be simplified going forward. No intentional functional impact. Signed-off-by: Rafael J. Wysocki Reviewed-by: Daniel Lezcano --- drivers/acpi/thermal.c | 105 ++++++++++++++++++++++++------------------------- 1 file changed, 52 insertions(+), 53 deletions(-) Index: linux-pm/drivers/acpi/thermal.c =================================================================== --- linux-pm.orig/drivers/acpi/thermal.c +++ linux-pm/drivers/acpi/thermal.c @@ -688,53 +688,10 @@ static void acpi_thermal_zone_sysfs_remo } static int acpi_thermal_register_thermal_zone(struct acpi_thermal *tz, - unsigned int trip_count) + unsigned int trip_count, + int passive_delay) { - struct acpi_thermal_trip *acpi_trip; - struct thermal_trip *trip; - int passive_delay = 0; int result; - int i; - - trip = kcalloc(trip_count, sizeof(*trip), GFP_KERNEL); - if (!trip) - return -ENOMEM; - - tz->trip_table = trip; - - if (tz->trips.critical.valid) { - trip->type = THERMAL_TRIP_CRITICAL; - trip->temperature = acpi_thermal_temp(tz, tz->trips.critical.temperature); - trip++; - } - - if (tz->trips.hot.valid) { - trip->type = THERMAL_TRIP_HOT; - trip->temperature = acpi_thermal_temp(tz, tz->trips.hot.temperature); - trip++; - } - - acpi_trip = &tz->trips.passive.trip; - if (acpi_trip->valid) { - passive_delay = tz->trips.passive.tsp * 100; - - trip->type = THERMAL_TRIP_PASSIVE; - trip->temperature = acpi_thermal_temp(tz, acpi_trip->temperature); - trip->priv = acpi_trip; - trip++; - } - - for (i = 0; i < ACPI_THERMAL_MAX_ACTIVE; i++) { - acpi_trip = &tz->trips.active[i].trip; - - if (!acpi_trip->valid) - break; - - trip->type = THERMAL_TRIP_ACTIVE; - trip->temperature = acpi_thermal_temp(tz, acpi_trip->temperature); - trip->priv = acpi_trip; - trip++; - } tz->thermal_zone = thermal_zone_device_register_with_trips("acpitz", tz->trip_table, @@ -744,10 +701,8 @@ static int acpi_thermal_register_thermal NULL, passive_delay, tz->polling_frequency * 100); - if (IS_ERR(tz->thermal_zone)) { - result = PTR_ERR(tz->thermal_zone); - goto free_trip_table; - } + if (IS_ERR(tz->thermal_zone)) + return PTR_ERR(tz->thermal_zone); result = acpi_thermal_zone_sysfs_add(tz); if (result) @@ -766,8 +721,6 @@ remove_links: acpi_thermal_zone_sysfs_remove(tz); unregister_tzd: thermal_zone_device_unregister(tz->thermal_zone); -free_trip_table: - kfree(tz->trip_table); return result; } @@ -886,9 +839,13 @@ static void acpi_thermal_check_fn(struct static int acpi_thermal_add(struct acpi_device *device) { + struct acpi_thermal_trip *acpi_trip; + struct thermal_trip *trip; struct acpi_thermal *tz; unsigned int trip_count; + int passive_delay = 0; int result; + int i; if (!device) return -EINVAL; @@ -930,9 +887,49 @@ static int acpi_thermal_add(struct acpi_ acpi_thermal_guess_offset(tz); - result = acpi_thermal_register_thermal_zone(tz, trip_count); + trip = kcalloc(trip_count, sizeof(*trip), GFP_KERNEL); + if (!trip) + return -ENOMEM; + + tz->trip_table = trip; + + if (tz->trips.critical.valid) { + trip->type = THERMAL_TRIP_CRITICAL; + trip->temperature = acpi_thermal_temp(tz, tz->trips.critical.temperature); + trip++; + } + + if (tz->trips.hot.valid) { + trip->type = THERMAL_TRIP_HOT; + trip->temperature = acpi_thermal_temp(tz, tz->trips.hot.temperature); + trip++; + } + + acpi_trip = &tz->trips.passive.trip; + if (acpi_trip->valid) { + passive_delay = tz->trips.passive.tsp * 100; + + trip->type = THERMAL_TRIP_PASSIVE; + trip->temperature = acpi_thermal_temp(tz, acpi_trip->temperature); + trip->priv = acpi_trip; + trip++; + } + + for (i = 0; i < ACPI_THERMAL_MAX_ACTIVE; i++) { + acpi_trip = &tz->trips.active[i].trip; + + if (!acpi_trip->valid) + break; + + trip->type = THERMAL_TRIP_ACTIVE; + trip->temperature = acpi_thermal_temp(tz, acpi_trip->temperature); + trip->priv = acpi_trip; + trip++; + } + + result = acpi_thermal_register_thermal_zone(tz, trip_count, passive_delay); if (result) - goto free_memory; + goto free_trips; refcount_set(&tz->thermal_check_count, 3); mutex_init(&tz->thermal_check_lock); @@ -951,6 +948,8 @@ static int acpi_thermal_add(struct acpi_ flush_wq: flush_workqueue(acpi_thermal_pm_queue); acpi_thermal_unregister_thermal_zone(tz); +free_trips: + kfree(tz->trip_table); free_memory: kfree(tz); From patchwork Tue Sep 12 18:41:06 2023 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: "Rafael J. Wysocki" X-Patchwork-Id: 13382062 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from vger.kernel.org (vger.kernel.org [23.128.96.18]) by smtp.lore.kernel.org (Postfix) with ESMTP id 08190EE3F0D for ; Tue, 12 Sep 2023 18:47:53 +0000 (UTC) Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S237542AbjILSrz (ORCPT ); Tue, 12 Sep 2023 14:47:55 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:46494 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S237535AbjILSrp (ORCPT ); Tue, 12 Sep 2023 14:47:45 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id F0A7F10F6; Tue, 12 Sep 2023 11:47:40 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.2.0) id 14a9d9dd490c3409; Tue, 12 Sep 2023 20:47:39 +0200 Authentication-Results: v370.home.net.pl; spf=softfail (domain owner discourages use of this host) smtp.mailfrom=rjwysocki.net (client-ip=195.136.19.94; helo=[195.136.19.94]; envelope-from=rjw@rjwysocki.net; receiver=) Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id 81E38663C2D; Tue, 12 Sep 2023 20:47:38 +0200 (CEST) From: "Rafael J. Wysocki" To: Linux ACPI Cc: LKML , Linux PM , Zhang Rui , Srinivas Pandruvada , Daniel Lezcano Subject: [PATCH v1 5/9] ACPI: thermal: Simplify critical and hot trips representation Date: Tue, 12 Sep 2023 20:41:06 +0200 Message-ID: <3249479.aeNJFYEL58@kreacher> In-Reply-To: <5708760.DvuYhMxLoT@kreacher> References: <5708760.DvuYhMxLoT@kreacher> MIME-Version: 1.0 X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedviedrudeiiedgudeftdcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfjqffogffrnfdpggftiffpkfenuceurghilhhouhhtmecuudehtdenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhephffvvefufffkjghfggfgtgesthfuredttddtjeenucfhrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqeenucggtffrrghtthgvrhhnpedvffeuiedtgfdvtddugeeujedtffetteegfeekffdvfedttddtuefhgeefvdejhfenucfkphepudelhedrudefiedrudelrdelgeenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpeduleehrddufeeirdduledrleegpdhhvghlohepkhhrvggrtghhvghrrdhlohgtrghlnhgvthdpmhgrihhlfhhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqpdhnsggprhgtphhtthhopeeipdhrtghpthhtoheplhhinhhugidqrggtphhisehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqkhgvrhhnvghlsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqphhmsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheprhhuihdriihhrghnghesihhnthgvlhdrtghomhdprhgtphhtthhopehs rhhinhhivhgrshdrphgrnhgurhhuvhgruggrsehlihhnuhigrdhinhhtvghlrdgtohhmpdhrtghpthhtohepuggrnhhivghlrdhlvgiitggrnhhosehlihhnrghrohdrohhrgh X-DCC--Metrics: v370.home.net.pl 1024; Body=6 Fuz1=6 Fuz2=6 Precedence: bulk List-ID: X-Mailing-List: linux-acpi@vger.kernel.org From: Rafael J. Wysocki Notice that the only piece of information regarding the critical and hot trips that needs to be stored in the driver's local data structures is whether or not these trips are valid, so drop all of the redundant information from there and adjust the code accordingly. Among other things, this requires acpi_thermal_add() to be rearranged so as to obtain the critical trip temperature before populating the trip points table and for symmetry, the hot trip temperature is obtained earlier too. No intentional functional impact. Signed-off-by: Rafael J. Wysocki Reviewed-by: Daniel Lezcano --- drivers/acpi/thermal.c | 69 +++++++++++++++++++++++-------------------------- 1 file changed, 33 insertions(+), 36 deletions(-) Index: linux-pm/drivers/acpi/thermal.c =================================================================== --- linux-pm.orig/drivers/acpi/thermal.c +++ linux-pm/drivers/acpi/thermal.c @@ -107,10 +107,10 @@ struct acpi_thermal_active { }; struct acpi_thermal_trips { - struct acpi_thermal_trip critical; - struct acpi_thermal_trip hot; struct acpi_thermal_passive passive; struct acpi_thermal_active active[ACPI_THERMAL_MAX_ACTIVE]; + bool critical_valid; + bool hot_valid; }; struct acpi_thermal { @@ -391,7 +391,7 @@ static void acpi_thermal_trips_update(st dev_name(&adev->dev), event, 0); } -static void acpi_thermal_get_critical_trip(struct acpi_thermal *tz) +static long acpi_thermal_get_critical_trip(struct acpi_thermal *tz) { unsigned long long tmp; acpi_status status; @@ -420,34 +420,30 @@ static void acpi_thermal_get_critical_tr } set: - tz->trips.critical.valid = true; - tz->trips.critical.temperature = tmp; - acpi_handle_debug(tz->device->handle, "Critical threshold [%lu]\n", - tz->trips.critical.temperature); - return; + tz->trips.critical_valid = true; + acpi_handle_debug(tz->device->handle, "Critical threshold [%llu]\n", tmp); + return tmp; fail: - tz->trips.critical.valid = false; - tz->trips.critical.temperature = THERMAL_TEMP_INVALID; + tz->trips.critical_valid = false; + return THERMAL_TEMP_INVALID; } -static void acpi_thermal_get_hot_trip(struct acpi_thermal *tz) +static long acpi_thermal_get_hot_trip(struct acpi_thermal *tz) { unsigned long long tmp; acpi_status status; status = acpi_evaluate_integer(tz->device->handle, "_HOT", NULL, &tmp); if (ACPI_FAILURE(status)) { - tz->trips.hot.valid = false; - tz->trips.hot.temperature = THERMAL_TEMP_INVALID; + tz->trips.hot_valid = false; acpi_handle_debug(tz->device->handle, "No hot threshold\n"); - return; + return THERMAL_TEMP_INVALID; } - tz->trips.hot.valid = true; - tz->trips.hot.temperature = tmp; - acpi_handle_debug(tz->device->handle, "Hot threshold [%lu]\n", - tz->trips.hot.temperature); + tz->trips.hot_valid = true; + acpi_handle_debug(tz->device->handle, "Hot threshold [%llu]\n", tmp); + return tmp; } static int acpi_thermal_get_trip_points(struct acpi_thermal *tz) @@ -455,17 +451,9 @@ static int acpi_thermal_get_trip_points( unsigned int count = 0; int i; - acpi_thermal_get_critical_trip(tz); - acpi_thermal_get_hot_trip(tz); /* Passive and active trip points (optional). */ __acpi_thermal_trips_update(tz, ACPI_TRIPS_INIT); - if (tz->trips.critical.valid) - count++; - - if (tz->trips.hot.valid) - count++; - if (tz->trips.passive.trip.valid) count++; @@ -578,10 +566,10 @@ static int acpi_thermal_cooling_device_c int trip = -1; int result = 0; - if (tz->trips.critical.valid) + if (tz->trips.critical_valid) trip++; - if (tz->trips.hot.valid) + if (tz->trips.hot_valid) trip++; if (tz->trips.passive.trip.valid) { @@ -803,10 +791,9 @@ static void acpi_thermal_aml_dependency_ * The heuristic below should work for all ACPI thermal zones which have a * critical trip point with a value being a multiple of 0.5 degree Celsius. */ -static void acpi_thermal_guess_offset(struct acpi_thermal *tz) +static void acpi_thermal_guess_offset(struct acpi_thermal *tz, long crit_temp) { - if (tz->trips.critical.valid && - (tz->trips.critical.temperature % 5) == 1) + if (tz->trips.critical_valid && crit_temp % 5 == 1) tz->kelvin_offset = 273100; else tz->kelvin_offset = 273200; @@ -843,6 +830,7 @@ static int acpi_thermal_add(struct acpi_ struct thermal_trip *trip; struct acpi_thermal *tz; unsigned int trip_count; + int crit_temp, hot_temp; int passive_delay = 0; int result; int i; @@ -864,6 +852,15 @@ static int acpi_thermal_add(struct acpi_ /* Get trip points [_CRT, _PSV, etc.] (required). */ trip_count = acpi_thermal_get_trip_points(tz); + + crit_temp = acpi_thermal_get_critical_trip(tz); + if (tz->trips.critical_valid) + trip_count++; + + hot_temp = acpi_thermal_get_hot_trip(tz); + if (tz->trips.hot_valid) + trip_count++; + if (!trip_count) { pr_warn(FW_BUG "No valid trip points!\n"); result = -ENODEV; @@ -885,7 +882,7 @@ static int acpi_thermal_add(struct acpi_ else acpi_thermal_get_polling_frequency(tz); - acpi_thermal_guess_offset(tz); + acpi_thermal_guess_offset(tz, crit_temp); trip = kcalloc(trip_count, sizeof(*trip), GFP_KERNEL); if (!trip) @@ -893,15 +890,15 @@ static int acpi_thermal_add(struct acpi_ tz->trip_table = trip; - if (tz->trips.critical.valid) { + if (tz->trips.critical_valid) { trip->type = THERMAL_TRIP_CRITICAL; - trip->temperature = acpi_thermal_temp(tz, tz->trips.critical.temperature); + trip->temperature = acpi_thermal_temp(tz, crit_temp); trip++; } - if (tz->trips.hot.valid) { + if (tz->trips.hot_valid) { trip->type = THERMAL_TRIP_HOT; - trip->temperature = acpi_thermal_temp(tz, tz->trips.hot.temperature); + trip->temperature = acpi_thermal_temp(tz, hot_temp); trip++; } From patchwork Tue Sep 12 18:43:52 2023 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: "Rafael J. Wysocki" X-Patchwork-Id: 13382060 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from vger.kernel.org (vger.kernel.org [23.128.96.18]) by smtp.lore.kernel.org (Postfix) with ESMTP id A1FFCEE3F0C for ; Tue, 12 Sep 2023 18:47:52 +0000 (UTC) Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S237616AbjILSrz (ORCPT ); Tue, 12 Sep 2023 14:47:55 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:46476 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S237523AbjILSro (ORCPT ); Tue, 12 Sep 2023 14:47:44 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id ADBBA10DF; Tue, 12 Sep 2023 11:47:39 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.2.0) id b410579ed5f883e6; Tue, 12 Sep 2023 20:47:38 +0200 Authentication-Results: v370.home.net.pl; spf=softfail (domain owner discourages use of this host) smtp.mailfrom=rjwysocki.net (client-ip=195.136.19.94; helo=[195.136.19.94]; envelope-from=rjw@rjwysocki.net; receiver=) Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id 36EB3663BE5; Tue, 12 Sep 2023 20:47:37 +0200 (CEST) From: "Rafael J. Wysocki" To: Linux ACPI Cc: LKML , Linux PM , Zhang Rui , Srinivas Pandruvada , Daniel Lezcano Subject: [PATCH v1 6/9] ACPI: thermal: Untangle initialization and updates of the passive trip Date: Tue, 12 Sep 2023 20:43:52 +0200 Message-ID: <1942063.PYKUYFuaPT@kreacher> In-Reply-To: <5708760.DvuYhMxLoT@kreacher> References: <5708760.DvuYhMxLoT@kreacher> MIME-Version: 1.0 X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedviedrudeiiedgudeftdcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfjqffogffrnfdpggftiffpkfenuceurghilhhouhhtmecuudehtdenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhephffvvefufffkjghfggfgtgesthfuredttddtjeenucfhrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqeenucggtffrrghtthgvrhhnpedvffeuiedtgfdvtddugeeujedtffetteegfeekffdvfedttddtuefhgeefvdejhfenucfkphepudelhedrudefiedrudelrdelgeenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpeduleehrddufeeirdduledrleegpdhhvghlohepkhhrvggrtghhvghrrdhlohgtrghlnhgvthdpmhgrihhlfhhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqpdhnsggprhgtphhtthhopeeipdhrtghpthhtoheplhhinhhugidqrggtphhisehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqkhgvrhhnvghlsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqphhmsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheprhhuihdriihhrghnghesihhnthgvlhdrtghomhdprhgtphhtthhopehs rhhinhhivhgrshdrphgrnhgurhhuvhgruggrsehlihhnuhigrdhinhhtvghlrdgtohhmpdhrtghpthhtohepuggrnhhivghlrdhlvgiitggrnhhosehlihhnrghrohdrohhrgh X-DCC--Metrics: v370.home.net.pl 1024; Body=6 Fuz1=6 Fuz2=6 Precedence: bulk List-ID: X-Mailing-List: linux-acpi@vger.kernel.org From: Rafael J. Wysocki Separate the code needed to update the passive trip (in a response to a notification from the platform firmware) as well as to initialize it from the code that is only necessary for its initialization and cleanly divide it into functions that each carry out a specific action. Signed-off-by: Rafael J. Wysocki Reviewed-by: Daniel Lezcano --- drivers/acpi/thermal.c | 198 ++++++++++++++++++++++++++++++------------------- 1 file changed, 125 insertions(+), 73 deletions(-) Index: linux-pm/drivers/acpi/thermal.c =================================================================== --- linux-pm.orig/drivers/acpi/thermal.c +++ linux-pm/drivers/acpi/thermal.c @@ -192,73 +192,6 @@ static void __acpi_thermal_trips_update( bool valid = false; int i; - /* Passive (optional) */ - if (((flag & ACPI_TRIPS_PASSIVE) && tz->trips.passive.trip.valid) || - flag == ACPI_TRIPS_INIT) { - valid = tz->trips.passive.trip.valid; - if (psv == -1) { - status = AE_SUPPORT; - } else if (psv > 0) { - tmp = celsius_to_deci_kelvin(psv); - status = AE_OK; - } else { - status = acpi_evaluate_integer(tz->device->handle, - "_PSV", NULL, &tmp); - } - - if (ACPI_FAILURE(status)) { - tz->trips.passive.trip.valid = false; - } else { - tz->trips.passive.trip.temperature = tmp; - tz->trips.passive.trip.valid = true; - if (flag == ACPI_TRIPS_INIT) { - status = acpi_evaluate_integer(tz->device->handle, - "_TC1", NULL, &tmp); - if (ACPI_FAILURE(status)) - tz->trips.passive.trip.valid = false; - else - tz->trips.passive.tc1 = tmp; - - status = acpi_evaluate_integer(tz->device->handle, - "_TC2", NULL, &tmp); - if (ACPI_FAILURE(status)) - tz->trips.passive.trip.valid = false; - else - tz->trips.passive.tc2 = tmp; - - status = acpi_evaluate_integer(tz->device->handle, - "_TSP", NULL, &tmp); - if (ACPI_FAILURE(status)) - tz->trips.passive.trip.valid = false; - else - tz->trips.passive.tsp = tmp; - } - } - } - if ((flag & ACPI_TRIPS_DEVICES) && tz->trips.passive.trip.valid) { - memset(&devices, 0, sizeof(struct acpi_handle_list)); - status = acpi_evaluate_reference(tz->device->handle, "_PSL", - NULL, &devices); - if (ACPI_FAILURE(status)) { - acpi_handle_info(tz->device->handle, - "Invalid passive threshold\n"); - tz->trips.passive.trip.valid = false; - } else { - tz->trips.passive.trip.valid = true; - } - - if (memcmp(&tz->trips.passive.devices, &devices, - sizeof(struct acpi_handle_list))) { - memcpy(&tz->trips.passive.devices, &devices, - sizeof(struct acpi_handle_list)); - ACPI_THERMAL_TRIPS_EXCEPTION(flag, tz, "device"); - } - } - if ((flag & ACPI_TRIPS_PASSIVE) || (flag & ACPI_TRIPS_DEVICES)) { - if (valid != tz->trips.passive.trip.valid) - ACPI_THERMAL_TRIPS_EXCEPTION(flag, tz, "state"); - } - /* Active (optional) */ for (i = 0; i < ACPI_THERMAL_MAX_ACTIVE; i++) { char name[5] = { '_', 'A', 'C', ('0' + i), '\0' }; @@ -339,6 +272,72 @@ static void __acpi_thermal_trips_update( } } +static void update_acpi_thermal_trip_temp(struct acpi_thermal_trip *acpi_trip, + int temp) +{ + acpi_trip->valid = temp != THERMAL_TEMP_INVALID; + acpi_trip->temperature = temp; +} + +static long get_passive_temp(struct acpi_thermal *tz) +{ + unsigned long long tmp; + acpi_status status; + + status = acpi_evaluate_integer(tz->device->handle, "_PSV", NULL, &tmp); + if (ACPI_FAILURE(status)) + return THERMAL_TEMP_INVALID; + + return tmp; +} + +static void acpi_thermal_update_passive_trip(struct acpi_thermal *tz) +{ + struct acpi_thermal_trip *acpi_trip = &tz->trips.passive.trip; + + if (!acpi_trip->valid || psv > 0) + return; + + update_acpi_thermal_trip_temp(acpi_trip, get_passive_temp(tz)); + if (!acpi_trip->valid) + ACPI_THERMAL_TRIPS_EXCEPTION(ACPI_TRIPS_PASSIVE, tz, "state"); +} + +static bool update_passive_devices(struct acpi_thermal *tz, bool compare) +{ + struct acpi_handle_list devices; + acpi_status status; + + memset(&devices, 0, sizeof(devices)); + + status = acpi_evaluate_reference(tz->device->handle, "_PSL", NULL, &devices); + if (ACPI_FAILURE(status)) { + acpi_handle_info(tz->device->handle, + "Missing device list for passive threshold\n"); + return false; + } + + if (compare && memcmp(&tz->trips.passive.devices, &devices, sizeof(devices))) + ACPI_THERMAL_TRIPS_EXCEPTION(ACPI_TRIPS_PASSIVE, tz, "device"); + + memcpy(&tz->trips.passive.devices, &devices, sizeof(devices)); + return true; +} + +static void acpi_thermal_update_passive_devices(struct acpi_thermal *tz) +{ + struct acpi_thermal_trip *acpi_trip = &tz->trips.passive.trip; + + if (!acpi_trip->valid) + return; + + if (update_passive_devices(tz, true)) + return; + + update_acpi_thermal_trip_temp(acpi_trip, THERMAL_TEMP_INVALID); + ACPI_THERMAL_TRIPS_EXCEPTION(ACPI_TRIPS_PASSIVE, tz, "state"); +} + static int acpi_thermal_adjust_trip(struct thermal_trip *trip, void *data) { struct acpi_thermal_trip *acpi_trip = trip->priv; @@ -359,8 +358,15 @@ static void acpi_thermal_adjust_thermal_ unsigned long data) { struct acpi_thermal *tz = thermal_zone_device_priv(thermal); - int flag = data == ACPI_THERMAL_NOTIFY_THRESHOLDS ? - ACPI_TRIPS_THRESHOLDS : ACPI_TRIPS_DEVICES; + int flag; + + if (data == ACPI_THERMAL_NOTIFY_THRESHOLDS) { + acpi_thermal_update_passive_trip(tz); + flag = ACPI_TRIPS_THRESHOLDS; + } else { + acpi_thermal_update_passive_devices(tz); + flag = ACPI_TRIPS_DEVICES; + } __acpi_thermal_trips_update(tz, flag); @@ -446,17 +452,63 @@ static long acpi_thermal_get_hot_trip(st return tmp; } +static bool acpi_thermal_init_passive_trip(struct acpi_thermal *tz) +{ + unsigned long long tmp; + acpi_status status; + int temp; + + if (psv == -1) + goto fail; + + if (psv > 0) { + temp = celsius_to_deci_kelvin(psv); + } else { + temp = get_passive_temp(tz); + if (temp == THERMAL_TEMP_INVALID) + goto fail; + } + + status = acpi_evaluate_integer(tz->device->handle, "_TC1", NULL, &tmp); + if (ACPI_FAILURE(status)) + goto fail; + + tz->trips.passive.tc1 = tmp; + + status = acpi_evaluate_integer(tz->device->handle, "_TC2", NULL, &tmp); + if (ACPI_FAILURE(status)) + goto fail; + + tz->trips.passive.tc2 = tmp; + + status = acpi_evaluate_integer(tz->device->handle, "_TSP", NULL, &tmp); + if (ACPI_FAILURE(status)) + goto fail; + + tz->trips.passive.tsp = tmp; + + if (!update_passive_devices(tz, false)) + goto fail; + + update_acpi_thermal_trip_temp(&tz->trips.passive.trip, temp); + return true; + +fail: + update_acpi_thermal_trip_temp(&tz->trips.passive.trip, THERMAL_TEMP_INVALID); + return false; +} + static int acpi_thermal_get_trip_points(struct acpi_thermal *tz) { unsigned int count = 0; int i; - /* Passive and active trip points (optional). */ - __acpi_thermal_trips_update(tz, ACPI_TRIPS_INIT); - - if (tz->trips.passive.trip.valid) + if (acpi_thermal_init_passive_trip(tz)) count++; + /* Active trip points (optional). */ + __acpi_thermal_trips_update(tz, ACPI_TRIPS_INIT); + for (i = 0; i < ACPI_THERMAL_MAX_ACTIVE; i++) { if (tz->trips.active[i].trip.valid) count++; From patchwork Tue Sep 12 18:43:59 2023 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: "Rafael J. Wysocki" X-Patchwork-Id: 13382059 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from vger.kernel.org (vger.kernel.org [23.128.96.18]) by smtp.lore.kernel.org (Postfix) with ESMTP id C204DEE3F0D for ; Tue, 12 Sep 2023 18:47:41 +0000 (UTC) Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S237508AbjILSro (ORCPT ); Tue, 12 Sep 2023 14:47:44 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:46426 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S237498AbjILSrm (ORCPT ); Tue, 12 Sep 2023 14:47:42 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id 6459D10D3; Tue, 12 Sep 2023 11:47:38 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.2.0) id c5c47177dc7dc82b; Tue, 12 Sep 2023 20:47:36 +0200 Authentication-Results: v370.home.net.pl; spf=softfail (domain owner discourages use of this host) smtp.mailfrom=rjwysocki.net (client-ip=195.136.19.94; helo=[195.136.19.94]; envelope-from=rjw@rjwysocki.net; receiver=) Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id 604C4663BE5; Tue, 12 Sep 2023 20:47:36 +0200 (CEST) From: "Rafael J. Wysocki" To: Linux ACPI Cc: LKML , Linux PM , Zhang Rui , Srinivas Pandruvada , Daniel Lezcano Subject: [PATCH v1 7/9] ACPI: thermal: Untangle initialization and updates of active trips Date: Tue, 12 Sep 2023 20:43:59 +0200 Message-ID: <22010294.EfDdHjke4D@kreacher> In-Reply-To: <5708760.DvuYhMxLoT@kreacher> References: <5708760.DvuYhMxLoT@kreacher> MIME-Version: 1.0 X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedviedrudeiiedgudeftdcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfjqffogffrnfdpggftiffpkfenuceurghilhhouhhtmecuudehtdenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhephffvvefufffkjghfggfgtgesthfuredttddtjeenucfhrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqeenucggtffrrghtthgvrhhnpedvffeuiedtgfdvtddugeeujedtffetteegfeekffdvfedttddtuefhgeefvdejhfenucfkphepudelhedrudefiedrudelrdelgeenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpeduleehrddufeeirdduledrleegpdhhvghlohepkhhrvggrtghhvghrrdhlohgtrghlnhgvthdpmhgrihhlfhhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqpdhnsggprhgtphhtthhopeeipdhrtghpthhtoheplhhinhhugidqrggtphhisehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqkhgvrhhnvghlsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqphhmsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheprhhuihdriihhrghnghesihhnthgvlhdrtghomhdprhgtphhtthhopehs rhhinhhivhgrshdrphgrnhgurhhuvhgruggrsehlihhnuhigrdhinhhtvghlrdgtohhmpdhrtghpthhtohepuggrnhhivghlrdhlvgiitggrnhhosehlihhnrghrohdrohhrgh X-DCC--Metrics: v370.home.net.pl 1024; Body=6 Fuz1=6 Fuz2=6 Precedence: bulk List-ID: X-Mailing-List: linux-acpi@vger.kernel.org From: Rafael J. Wysocki Separate the code needed to update active trips (in a response to a notification from the platform firmware) as well as to initialize them from the code that is only necessary for their initialization and cleanly divide it into functions that each carry out a specific action. Signed-off-by: Rafael J. Wysocki Acked-by: Daniel Lezcano --- drivers/acpi/thermal.c | 197 ++++++++++++++++++++++++------------------------- 1 file changed, 100 insertions(+), 97 deletions(-) Index: linux-pm/drivers/acpi/thermal.c =================================================================== --- linux-pm.orig/drivers/acpi/thermal.c +++ linux-pm/drivers/acpi/thermal.c @@ -184,94 +184,6 @@ static int acpi_thermal_temp(struct acpi tz->kelvin_offset); } -static void __acpi_thermal_trips_update(struct acpi_thermal *tz, int flag) -{ - acpi_status status; - unsigned long long tmp; - struct acpi_handle_list devices; - bool valid = false; - int i; - - /* Active (optional) */ - for (i = 0; i < ACPI_THERMAL_MAX_ACTIVE; i++) { - char name[5] = { '_', 'A', 'C', ('0' + i), '\0' }; - valid = tz->trips.active[i].trip.valid; - - if (act == -1) - break; /* disable all active trip points */ - - if (flag == ACPI_TRIPS_INIT || ((flag & ACPI_TRIPS_ACTIVE) && - tz->trips.active[i].trip.valid)) { - status = acpi_evaluate_integer(tz->device->handle, - name, NULL, &tmp); - if (ACPI_FAILURE(status)) { - tz->trips.active[i].trip.valid = false; - if (i == 0) - break; - - if (act <= 0) - break; - - if (i == 1) - tz->trips.active[0].trip.temperature = - celsius_to_deci_kelvin(act); - else - /* - * Don't allow override higher than - * the next higher trip point - */ - tz->trips.active[i-1].trip.temperature = - min_t(unsigned long, - tz->trips.active[i-2].trip.temperature, - celsius_to_deci_kelvin(act)); - - break; - } else { - tz->trips.active[i].trip.temperature = tmp; - tz->trips.active[i].trip.valid = true; - } - } - - name[2] = 'L'; - if ((flag & ACPI_TRIPS_DEVICES) && tz->trips.active[i].trip.valid) { - memset(&devices, 0, sizeof(struct acpi_handle_list)); - status = acpi_evaluate_reference(tz->device->handle, - name, NULL, &devices); - if (ACPI_FAILURE(status)) { - acpi_handle_info(tz->device->handle, - "Invalid active%d threshold\n", i); - tz->trips.active[i].trip.valid = false; - } else { - tz->trips.active[i].trip.valid = true; - } - - if (memcmp(&tz->trips.active[i].devices, &devices, - sizeof(struct acpi_handle_list))) { - memcpy(&tz->trips.active[i].devices, &devices, - sizeof(struct acpi_handle_list)); - ACPI_THERMAL_TRIPS_EXCEPTION(flag, tz, "device"); - } - } - if ((flag & ACPI_TRIPS_ACTIVE) || (flag & ACPI_TRIPS_DEVICES)) - if (valid != tz->trips.active[i].trip.valid) - ACPI_THERMAL_TRIPS_EXCEPTION(flag, tz, "state"); - - if (!tz->trips.active[i].trip.valid) - break; - } - - if (flag & ACPI_TRIPS_DEVICES) { - memset(&devices, 0, sizeof(devices)); - status = acpi_evaluate_reference(tz->device->handle, "_TZD", - NULL, &devices); - if (ACPI_SUCCESS(status) && - memcmp(&tz->devices, &devices, sizeof(devices))) { - tz->devices = devices; - ACPI_THERMAL_TRIPS_EXCEPTION(flag, tz, "device"); - } - } -} - static void update_acpi_thermal_trip_temp(struct acpi_thermal_trip *acpi_trip, int temp) { @@ -338,6 +250,78 @@ static void acpi_thermal_update_passive_ ACPI_THERMAL_TRIPS_EXCEPTION(ACPI_TRIPS_PASSIVE, tz, "state"); } +static long get_active_temp(struct acpi_thermal *tz, int index) +{ + char method[] = { '_', 'A', 'C', '0' + index, '\0' }; + unsigned long long tmp; + acpi_status status; + + status = acpi_evaluate_integer(tz->device->handle, method, NULL, &tmp); + if (ACPI_FAILURE(status)) + return THERMAL_TEMP_INVALID; + + /* + * If an override has been provided, apply it so there are no active + * trips with thresholds greater than the override. + */ + if (act > 0) { + unsigned long long override = celsius_to_deci_kelvin(act); + + if (tmp > override) + tmp = override; + } + return tmp; +} + +static void acpi_thermal_update_active_trip(struct acpi_thermal *tz, int index) +{ + struct acpi_thermal_trip *acpi_trip = &tz->trips.active[index].trip; + + if (!acpi_trip->valid) + return; + + update_acpi_thermal_trip_temp(acpi_trip, get_active_temp(tz, index)); + if (!acpi_trip->valid) + ACPI_THERMAL_TRIPS_EXCEPTION(ACPI_TRIPS_ACTIVE, tz, "state"); +} + +static bool update_active_devices(struct acpi_thermal *tz, int index, bool compare) +{ + char method[] = { '_', 'A', 'L', '0' + index, '\0' }; + struct acpi_handle_list devices; + acpi_status status; + + memset(&devices, 0, sizeof(devices)); + + status = acpi_evaluate_reference(tz->device->handle, method, NULL, &devices); + if (ACPI_FAILURE(status)) { + acpi_handle_info(tz->device->handle, + "Missing device list for active threshold %d\n", + index); + return false; + } + + if (compare && memcmp(&tz->trips.active[index].devices, &devices, sizeof(devices))) + ACPI_THERMAL_TRIPS_EXCEPTION(ACPI_TRIPS_ACTIVE, tz, "device"); + + memcpy(&tz->trips.active[index].devices, &devices, sizeof(devices)); + return true; +} + +static void acpi_thermal_update_active_devices(struct acpi_thermal *tz, int index) +{ + struct acpi_thermal_trip *acpi_trip = &tz->trips.active[index].trip; + + if (!acpi_trip->valid) + return; + + if (update_active_devices(tz, index, true)) + return; + + update_acpi_thermal_trip_temp(acpi_trip, THERMAL_TEMP_INVALID); + ACPI_THERMAL_TRIPS_EXCEPTION(ACPI_TRIPS_ACTIVE, tz, "state"); +} + static int acpi_thermal_adjust_trip(struct thermal_trip *trip, void *data) { struct acpi_thermal_trip *acpi_trip = trip->priv; @@ -358,18 +342,18 @@ static void acpi_thermal_adjust_thermal_ unsigned long data) { struct acpi_thermal *tz = thermal_zone_device_priv(thermal); - int flag; + int i; if (data == ACPI_THERMAL_NOTIFY_THRESHOLDS) { acpi_thermal_update_passive_trip(tz); - flag = ACPI_TRIPS_THRESHOLDS; + for (i = 0; i < ACPI_THERMAL_MAX_ACTIVE; i++) + acpi_thermal_update_active_trip(tz, i); } else { acpi_thermal_update_passive_devices(tz); - flag = ACPI_TRIPS_DEVICES; + for (i = 0; i < ACPI_THERMAL_MAX_ACTIVE; i++) + acpi_thermal_update_active_devices(tz, i); } - __acpi_thermal_trips_update(tz, flag); - for_each_thermal_trip(tz->thermal_zone, acpi_thermal_adjust_trip, tz); } @@ -498,6 +482,28 @@ fail: return false; } +static bool acpi_thermal_init_active_trip(struct acpi_thermal *tz, int index) +{ + long temp; + + if (act == -1) + goto fail; + + temp = get_active_temp(tz, index); + if (temp == THERMAL_TEMP_INVALID) + goto fail; + + if (!update_active_devices(tz, false, index)) + goto fail; + + update_acpi_thermal_trip_temp(&tz->trips.active[index].trip, temp); + return true; + +fail: + update_acpi_thermal_trip_temp(&tz->trips.active[index].trip, THERMAL_TEMP_INVALID); + return false; +} + static int acpi_thermal_get_trip_points(struct acpi_thermal *tz) { unsigned int count = 0; @@ -506,11 +512,8 @@ static int acpi_thermal_get_trip_points( if (acpi_thermal_init_passive_trip(tz)) count++; - /* Active trip points (optional). */ - __acpi_thermal_trips_update(tz, ACPI_TRIPS_INIT); - for (i = 0; i < ACPI_THERMAL_MAX_ACTIVE; i++) { - if (tz->trips.active[i].trip.valid) + if (acpi_thermal_init_active_trip(tz, i)) count++; else break; From patchwork Tue Sep 12 18:46:02 2023 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: "Rafael J. Wysocki" X-Patchwork-Id: 13382058 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from vger.kernel.org (vger.kernel.org [23.128.96.18]) by smtp.lore.kernel.org (Postfix) with ESMTP id C873DEE3F0E for ; Tue, 12 Sep 2023 18:47:39 +0000 (UTC) Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S237493AbjILSrm (ORCPT ); Tue, 12 Sep 2023 14:47:42 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:48906 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S237337AbjILSrl (ORCPT ); Tue, 12 Sep 2023 14:47:41 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id 642CB10D3; Tue, 12 Sep 2023 11:47:37 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.2.0) id e4066c49c5a5a305; Tue, 12 Sep 2023 20:47:35 +0200 Authentication-Results: v370.home.net.pl; spf=softfail (domain owner discourages use of this host) smtp.mailfrom=rjwysocki.net (client-ip=195.136.19.94; helo=[195.136.19.94]; envelope-from=rjw@rjwysocki.net; receiver=) Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id D70DE663BE5; Tue, 12 Sep 2023 20:47:34 +0200 (CEST) From: "Rafael J. Wysocki" To: Linux ACPI Cc: LKML , Linux PM , Zhang Rui , Srinivas Pandruvada , Daniel Lezcano Subject: [PATCH v1 8/9] ACPI: thermal: Drop redundant trip point flags Date: Tue, 12 Sep 2023 20:46:02 +0200 Message-ID: <3760530.kQq0lBPeGt@kreacher> In-Reply-To: <5708760.DvuYhMxLoT@kreacher> References: <5708760.DvuYhMxLoT@kreacher> MIME-Version: 1.0 X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedviedrudeiiedgudeftdcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfjqffogffrnfdpggftiffpkfenuceurghilhhouhhtmecuudehtdenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhephffvvefufffkjghfggfgtgesthfuredttddtjeenucfhrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqeenucggtffrrghtthgvrhhnpedvffeuiedtgfdvtddugeeujedtffetteegfeekffdvfedttddtuefhgeefvdejhfenucfkphepudelhedrudefiedrudelrdelgeenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpeduleehrddufeeirdduledrleegpdhhvghlohepkhhrvggrtghhvghrrdhlohgtrghlnhgvthdpmhgrihhlfhhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqpdhnsggprhgtphhtthhopeeipdhrtghpthhtoheplhhinhhugidqrggtphhisehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqkhgvrhhnvghlsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqphhmsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheprhhuihdriihhrghnghesihhnthgvlhdrtghomhdprhgtphhtthhopehs rhhinhhivhgrshdrphgrnhgurhhuvhgruggrsehlihhnuhigrdhinhhtvghlrdgtohhmpdhrtghpthhtohepuggrnhhivghlrdhlvgiitggrnhhosehlihhnrghrohdrohhrgh X-DCC--Metrics: v370.home.net.pl 1024; Body=6 Fuz1=6 Fuz2=6 Precedence: bulk List-ID: X-Mailing-List: linux-acpi@vger.kernel.org From: Rafael J. Wysocki Trip point flags previously used by the driver need not be used any more after the preceding changes, so drop them and adjust the code accordingly. No intentional functional impact. Signed-off-by: Rafael J. Wysocki Reviewed-by: Daniel Lezcano --- drivers/acpi/thermal.c | 29 ++++++++++------------------- 1 file changed, 10 insertions(+), 19 deletions(-) Index: linux-pm/drivers/acpi/thermal.c =================================================================== --- linux-pm.orig/drivers/acpi/thermal.c +++ linux-pm/drivers/acpi/thermal.c @@ -43,14 +43,6 @@ #define ACPI_THERMAL_MAX_ACTIVE 10 #define ACPI_THERMAL_MAX_LIMIT_STR_LEN 65 -#define ACPI_TRIPS_PASSIVE BIT(0) -#define ACPI_TRIPS_ACTIVE BIT(1) -#define ACPI_TRIPS_DEVICES BIT(2) - -#define ACPI_TRIPS_THRESHOLDS (ACPI_TRIPS_PASSIVE | ACPI_TRIPS_ACTIVE) - -#define ACPI_TRIPS_INIT (ACPI_TRIPS_THRESHOLDS | ACPI_TRIPS_DEVICES) - /* * This exception is thrown out in two cases: * 1.An invalid trip point becomes invalid or a valid trip point becomes invalid @@ -58,12 +50,11 @@ * 2.TODO: Devices listed in _PSL, _ALx, _TZD may change. * We need to re-bind the cooling devices of a thermal zone when this occurs. */ -#define ACPI_THERMAL_TRIPS_EXCEPTION(flags, tz, str) \ +#define ACPI_THERMAL_TRIPS_EXCEPTION(tz, str) \ do { \ - if (flags != ACPI_TRIPS_INIT) \ - acpi_handle_info(tz->device->handle, \ - "ACPI thermal trip point %s changed\n" \ - "Please report to linux-acpi@vger.kernel.org\n", str); \ + acpi_handle_info(tz->device->handle, \ + "ACPI thermal trip point %s changed\n" \ + "Please report to linux-acpi@vger.kernel.org\n", str); \ } while (0) static int act; @@ -212,7 +203,7 @@ static void acpi_thermal_update_passive_ update_acpi_thermal_trip_temp(acpi_trip, get_passive_temp(tz)); if (!acpi_trip->valid) - ACPI_THERMAL_TRIPS_EXCEPTION(ACPI_TRIPS_PASSIVE, tz, "state"); + ACPI_THERMAL_TRIPS_EXCEPTION(tz, "state"); } static bool update_passive_devices(struct acpi_thermal *tz, bool compare) @@ -230,7 +221,7 @@ static bool update_passive_devices(struc } if (compare && memcmp(&tz->trips.passive.devices, &devices, sizeof(devices))) - ACPI_THERMAL_TRIPS_EXCEPTION(ACPI_TRIPS_PASSIVE, tz, "device"); + ACPI_THERMAL_TRIPS_EXCEPTION(tz, "device"); memcpy(&tz->trips.passive.devices, &devices, sizeof(devices)); return true; @@ -247,7 +238,7 @@ static void acpi_thermal_update_passive_ return; update_acpi_thermal_trip_temp(acpi_trip, THERMAL_TEMP_INVALID); - ACPI_THERMAL_TRIPS_EXCEPTION(ACPI_TRIPS_PASSIVE, tz, "state"); + ACPI_THERMAL_TRIPS_EXCEPTION(tz, "state"); } static long get_active_temp(struct acpi_thermal *tz, int index) @@ -282,7 +273,7 @@ static void acpi_thermal_update_active_t update_acpi_thermal_trip_temp(acpi_trip, get_active_temp(tz, index)); if (!acpi_trip->valid) - ACPI_THERMAL_TRIPS_EXCEPTION(ACPI_TRIPS_ACTIVE, tz, "state"); + ACPI_THERMAL_TRIPS_EXCEPTION(tz, "state"); } static bool update_active_devices(struct acpi_thermal *tz, int index, bool compare) @@ -302,7 +293,7 @@ static bool update_active_devices(struct } if (compare && memcmp(&tz->trips.active[index].devices, &devices, sizeof(devices))) - ACPI_THERMAL_TRIPS_EXCEPTION(ACPI_TRIPS_ACTIVE, tz, "device"); + ACPI_THERMAL_TRIPS_EXCEPTION(tz, "device"); memcpy(&tz->trips.active[index].devices, &devices, sizeof(devices)); return true; @@ -319,7 +310,7 @@ static void acpi_thermal_update_active_d return; update_acpi_thermal_trip_temp(acpi_trip, THERMAL_TEMP_INVALID); - ACPI_THERMAL_TRIPS_EXCEPTION(ACPI_TRIPS_ACTIVE, tz, "state"); + ACPI_THERMAL_TRIPS_EXCEPTION(tz, "state"); } static int acpi_thermal_adjust_trip(struct thermal_trip *trip, void *data) From patchwork Tue Sep 12 18:47:23 2023 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: "Rafael J. Wysocki" X-Patchwork-Id: 13382057 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from vger.kernel.org (vger.kernel.org [23.128.96.18]) by smtp.lore.kernel.org (Postfix) with ESMTP id 6E681EE3F0D for ; Tue, 12 Sep 2023 18:47:38 +0000 (UTC) Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S234774AbjILSrl (ORCPT ); Tue, 12 Sep 2023 14:47:41 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:48872 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S231382AbjILSrk (ORCPT ); Tue, 12 Sep 2023 14:47:40 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id 4BEC810D3; Tue, 12 Sep 2023 11:47:36 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.2.0) id d591d3eab9350a03; Tue, 12 Sep 2023 20:47:33 +0200 Authentication-Results: v370.home.net.pl; spf=softfail (domain owner discourages use of this host) smtp.mailfrom=rjwysocki.net (client-ip=195.136.19.94; helo=[195.136.19.94]; envelope-from=rjw@rjwysocki.net; receiver=) Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id BAB64663C2D; Tue, 12 Sep 2023 20:47:32 +0200 (CEST) From: "Rafael J. Wysocki" To: Linux ACPI Cc: LKML , Linux PM , Zhang Rui , Srinivas Pandruvada , Daniel Lezcano Subject: [PATCH v1 9/9] ACPI: thermal: Drop valid flag from struct acpi_thermal_trip Date: Tue, 12 Sep 2023 20:47:23 +0200 Message-ID: <9162925.CDJkKcVGEf@kreacher> In-Reply-To: <5708760.DvuYhMxLoT@kreacher> References: <5708760.DvuYhMxLoT@kreacher> MIME-Version: 1.0 X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedviedrudeiiedgudeftdcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfjqffogffrnfdpggftiffpkfenuceurghilhhouhhtmecuudehtdenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhephffvvefufffkjghfggfgtgesthfuredttddtjeenucfhrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqeenucggtffrrghtthgvrhhnpedvffeuiedtgfdvtddugeeujedtffetteegfeekffdvfedttddtuefhgeefvdejhfenucfkphepudelhedrudefiedrudelrdelgeenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpeduleehrddufeeirdduledrleegpdhhvghlohepkhhrvggrtghhvghrrdhlohgtrghlnhgvthdpmhgrihhlfhhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqpdhnsggprhgtphhtthhopeeipdhrtghpthhtoheplhhinhhugidqrggtphhisehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqkhgvrhhnvghlsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqphhmsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheprhhuihdriihhrghnghesihhnthgvlhdrtghomhdprhgtphhtthhopehs rhhinhhivhgrshdrphgrnhgurhhuvhgruggrsehlihhnuhigrdhinhhtvghlrdgtohhmpdhrtghpthhtohepuggrnhhivghlrdhlvgiitggrnhhosehlihhnrghrohdrohhrgh X-DCC--Metrics: v370.home.net.pl 1024; Body=6 Fuz1=6 Fuz2=6 Precedence: bulk List-ID: X-Mailing-List: linux-acpi@vger.kernel.org From: Rafael J. Wysocki Notice that the valid flag in struct acpi_thermal_trip is in fact redundant, because the temperature field of invalid trips is always equal to THERMAL_TEMP_INVALID, so drop it from there and adjust the code accordingly. No intentional functional impact. Signed-off-by: Rafael J. Wysocki Acked-by: Daniel Lezcano Reviewed-by: Daniel Lezcano --- drivers/acpi/thermal.c | 49 +++++++++++++++++++++++-------------------------- 1 file changed, 23 insertions(+), 26 deletions(-) Index: linux-pm/drivers/acpi/thermal.c =================================================================== --- linux-pm.orig/drivers/acpi/thermal.c +++ linux-pm/drivers/acpi/thermal.c @@ -81,7 +81,6 @@ static struct workqueue_struct *acpi_the struct acpi_thermal_trip { unsigned long temperature; - bool valid; }; struct acpi_thermal_passive { @@ -175,11 +174,9 @@ static int acpi_thermal_temp(struct acpi tz->kelvin_offset); } -static void update_acpi_thermal_trip_temp(struct acpi_thermal_trip *acpi_trip, - int temp) +static bool acpi_thermal_trip_valid(struct acpi_thermal_trip *acpi_trip) { - acpi_trip->valid = temp != THERMAL_TEMP_INVALID; - acpi_trip->temperature = temp; + return acpi_trip->temperature != THERMAL_TEMP_INVALID; } static long get_passive_temp(struct acpi_thermal *tz) @@ -198,11 +195,11 @@ static void acpi_thermal_update_passive_ { struct acpi_thermal_trip *acpi_trip = &tz->trips.passive.trip; - if (!acpi_trip->valid || psv > 0) + if (!acpi_thermal_trip_valid(acpi_trip) || psv > 0) return; - update_acpi_thermal_trip_temp(acpi_trip, get_passive_temp(tz)); - if (!acpi_trip->valid) + acpi_trip->temperature = get_passive_temp(tz); + if (!acpi_thermal_trip_valid(acpi_trip)) ACPI_THERMAL_TRIPS_EXCEPTION(tz, "state"); } @@ -231,13 +228,13 @@ static void acpi_thermal_update_passive_ { struct acpi_thermal_trip *acpi_trip = &tz->trips.passive.trip; - if (!acpi_trip->valid) + if (!acpi_thermal_trip_valid(acpi_trip)) return; if (update_passive_devices(tz, true)) return; - update_acpi_thermal_trip_temp(acpi_trip, THERMAL_TEMP_INVALID); + acpi_trip->temperature = THERMAL_TEMP_INVALID; ACPI_THERMAL_TRIPS_EXCEPTION(tz, "state"); } @@ -268,11 +265,11 @@ static void acpi_thermal_update_active_t { struct acpi_thermal_trip *acpi_trip = &tz->trips.active[index].trip; - if (!acpi_trip->valid) + if (!acpi_thermal_trip_valid(acpi_trip)) return; - update_acpi_thermal_trip_temp(acpi_trip, get_active_temp(tz, index)); - if (!acpi_trip->valid) + acpi_trip->temperature = get_active_temp(tz, index); + if (!acpi_thermal_trip_valid(acpi_trip)) ACPI_THERMAL_TRIPS_EXCEPTION(tz, "state"); } @@ -303,13 +300,13 @@ static void acpi_thermal_update_active_d { struct acpi_thermal_trip *acpi_trip = &tz->trips.active[index].trip; - if (!acpi_trip->valid) + if (!acpi_thermal_trip_valid(acpi_trip)) return; if (update_active_devices(tz, index, true)) return; - update_acpi_thermal_trip_temp(acpi_trip, THERMAL_TEMP_INVALID); + acpi_trip->temperature = THERMAL_TEMP_INVALID; ACPI_THERMAL_TRIPS_EXCEPTION(tz, "state"); } @@ -321,7 +318,7 @@ static int acpi_thermal_adjust_trip(stru if (!acpi_trip) return 0; - if (acpi_trip->valid) + if (acpi_thermal_trip_valid(acpi_trip)) trip->temperature = acpi_thermal_temp(tz, acpi_trip->temperature); else trip->temperature = THERMAL_TEMP_INVALID; @@ -465,11 +462,11 @@ static bool acpi_thermal_init_passive_tr if (!update_passive_devices(tz, false)) goto fail; - update_acpi_thermal_trip_temp(&tz->trips.passive.trip, temp); + tz->trips.passive.trip.temperature = temp; return true; fail: - update_acpi_thermal_trip_temp(&tz->trips.passive.trip, THERMAL_TEMP_INVALID); + tz->trips.passive.trip.temperature = THERMAL_TEMP_INVALID; return false; } @@ -487,11 +484,11 @@ static bool acpi_thermal_init_active_tri if (!update_active_devices(tz, false, index)) goto fail; - update_acpi_thermal_trip_temp(&tz->trips.active[index].trip, temp); + tz->trips.active[index].trip.temperature = temp; return true; fail: - update_acpi_thermal_trip_temp(&tz->trips.active[index].trip, THERMAL_TEMP_INVALID); + tz->trips.active[index].trip.temperature = THERMAL_TEMP_INVALID; return false; } @@ -545,7 +542,7 @@ static int thermal_get_trend(struct ther return -EINVAL; acpi_trip = trip->priv; - if (!acpi_trip || !acpi_trip->valid) + if (!acpi_trip || !acpi_thermal_trip_valid(acpi_trip)) return -EINVAL; switch (trip->type) { @@ -618,7 +615,7 @@ static int acpi_thermal_cooling_device_c if (tz->trips.hot_valid) trip++; - if (tz->trips.passive.trip.valid) { + if (acpi_thermal_trip_valid(&tz->trips.passive.trip)) { trip++; for (i = 0; i < tz->trips.passive.devices.count; i++) { handle = tz->trips.passive.devices.handles[i]; @@ -643,7 +640,7 @@ static int acpi_thermal_cooling_device_c } for (i = 0; i < ACPI_THERMAL_MAX_ACTIVE; i++) { - if (!tz->trips.active[i].trip.valid) + if (!acpi_thermal_trip_valid(&tz->trips.active[i].trip)) break; trip++; @@ -949,7 +946,7 @@ static int acpi_thermal_add(struct acpi_ } acpi_trip = &tz->trips.passive.trip; - if (acpi_trip->valid) { + if (acpi_thermal_trip_valid(acpi_trip)) { passive_delay = tz->trips.passive.tsp * 100; trip->type = THERMAL_TRIP_PASSIVE; @@ -961,7 +958,7 @@ static int acpi_thermal_add(struct acpi_ for (i = 0; i < ACPI_THERMAL_MAX_ACTIVE; i++) { acpi_trip = &tz->trips.active[i].trip; - if (!acpi_trip->valid) + if (!acpi_thermal_trip_valid(acpi_trip)) break; trip->type = THERMAL_TRIP_ACTIVE; @@ -1038,7 +1035,7 @@ static int acpi_thermal_resume(struct de return -EINVAL; for (i = 0; i < ACPI_THERMAL_MAX_ACTIVE; i++) { - if (!tz->trips.active[i].trip.valid) + if (!acpi_thermal_trip_valid(&tz->trips.active[i].trip)) break; for (j = 0; j < tz->trips.active[i].devices.count; j++) {