From patchwork Mon Sep 16 16:31:29 2024 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 8bit X-Patchwork-Submitter: Arnd Bergmann X-Patchwork-Id: 13805632 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from smtp.kernel.org (aws-us-west-2-korg-mail-1.web.codeaurora.org [10.30.226.201]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by smtp.lore.kernel.org (Postfix) with ESMTPS id 09E01C3ABB2 for ; Mon, 16 Sep 2024 16:32:04 +0000 (UTC) Received: by smtp.kernel.org (Postfix) id E5361C4CEC5; Mon, 16 Sep 2024 16:32:03 +0000 (UTC) Received: from fout8-smtp.messagingengine.com (fout8-smtp.messagingengine.com [103.168.172.151]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by smtp.kernel.org (Postfix) with ESMTPS id C50E9C4CEC4 for ; Mon, 16 Sep 2024 16:31:59 +0000 (UTC) DMARC-Filter: OpenDMARC Filter v1.4.1 smtp.kernel.org C50E9C4CEC4 Authentication-Results: smtp.kernel.org; dmarc=pass (p=none dis=none) header.from=arndb.de Authentication-Results: smtp.kernel.org; spf=pass smtp.mailfrom=arndb.de Received: from phl-compute-10.internal (phl-compute-10.phl.internal [10.202.2.50]) by mailfout.phl.internal (Postfix) with ESMTP id E8E5513803C0; Mon, 16 Sep 2024 12:31:58 -0400 (EDT) Received: from phl-imap-11 ([10.202.2.101]) by phl-compute-10.internal (MEProxy); Mon, 16 Sep 2024 12:31:58 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=arndb.de; h=cc :cc:content-transfer-encoding:content-type:content-type:date :date:from:from:in-reply-to:in-reply-to:message-id:mime-version :references:reply-to:subject:subject:to:to; s=fm1; t=1726504318; x=1726590718; bh=KhDXFf6pKLEngzY9mT+p8rOsoT2UCZzt+yYgrMBpCcI=; b= pVPDGWqhu9aLywxBNekvaDbEdHv90elZK47oG/7DKPOkSx9V+rGmRdC2fyQFsC0t n29wQISEJxRy5A2zUB2Y27w4TLxgLPrDLatFNWbpXECb2FHgQ5hojRmu0N7yz+0H AO9JnbjdxiUaaB5Jj6ko1DETu6jU7SgDBXIoJXEmQuY1/0eVU7rhI1DbDV0aLoV8 yQvXRH0Jd3pqNskeoY3D+STYJJ92sEx5cohJLc83v+bSF8D3uaGwegoFRQu7gS5d +ZN3pabEkYLko9la7D5g09fjmfVBwjLOQYGaTFv1mS+vn2y2DkSMrKXfzTZwJDuq emSxYjnHuM4L5eTYcitKjA== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:cc:content-transfer-encoding :content-type:content-type:date:date:feedback-id:feedback-id :from:from:in-reply-to:in-reply-to:message-id:mime-version :references:reply-to:subject:subject:to:to:x-me-proxy:x-me-proxy :x-me-sender:x-me-sender:x-sasl-enc; s=fm1; t=1726504318; x= 1726590718; bh=KhDXFf6pKLEngzY9mT+p8rOsoT2UCZzt+yYgrMBpCcI=; b=i ruG6ibMHL/OGTx5LS+H5SL/t+AqjR5OLeqKN9oWoRmWHOum8PjPSd0K9cbiWsY2m 7/VnwTq4mDHa5TbTeYjnDbrH/2LjLXeVDH9Fz+hveGqkAbSHpE0uMLLF/hgice/5 3s1C4filMCrwgAwxDRDmXzggGoJH6z3cQJTaeKxRRX/IGUXx6k+Paw9HUK8PNX2e lfFVFEzxEA1ICejSBh/f3koir00yzr5NSEypREB5Wd9G2wcof1ctJ49tbKgEdt5G 65uoJElLx9cWVBkWYc3gXyeNqtH/yPKfk9YzqZxzb7VtMfBWik/ZqyWPT6Mxc7gi OtA2dwuU2s0R2ChdnhICg== X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeeftddrudekhedguddttdcutefuodetggdotefrod ftvfcurfhrohhfihhlvgemucfhrghsthforghilhdpggftfghnshhusghstghrihgsvgdp uffrtefokffrpgfnqfghnecuuegrihhlohhuthemuceftddtnecusecvtfgvtghiphhivg hnthhsucdlqddutddtmdenucfjughrpefoggffhffvvefkjghfufgtgfesthhqredtredt jeenucfhrhhomhepfdetrhhnugcuuegvrhhgmhgrnhhnfdcuoegrrhhnugesrghrnhgusg druggvqeenucggtffrrghtthgvrhhnpeefueegkeffveeugeehieehiedukeegfefhffeu tdettdffteeluefhheetkeekvdenucffohhmrghinhepkhgvrhhnvghlrdhorhhgpdhgih hthhhusgdrtghomhenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepmhgrihhl fhhrohhmpegrrhhnugesrghrnhgusgdruggvpdhnsggprhgtphhtthhopeegpdhmohguvg epshhmthhpohhuthdprhgtphhtthhopehsohgtsehkvghrnhgvlhdrohhrghdprhgtphht thhopehtohhrvhgrlhgusheslhhinhhugidqfhhouhhnuggrthhiohhnrdhorhhgpdhrtg hpthhtoheplhhinhhugidqrghrmhdqkhgvrhhnvghlsehlihhsthhsrdhinhhfrhgruggv rggurdhorhhgpdhrtghpthhtoheplhhinhhugidqkhgvrhhnvghlsehvghgvrhdrkhgvrh hnvghlrdhorhhg X-ME-Proxy: Feedback-ID: i56a14606:Fastmail Received: by mailuser.phl.internal (Postfix, from userid 501) id 92081222006F; Mon, 16 Sep 2024 12:31:58 -0400 (EDT) X-Mailer: MessagingEngine.com Webmail Interface MIME-Version: 1.0 Date: Mon, 16 Sep 2024 16:31:29 +0000 From: "Arnd Bergmann" To: "Linus Torvalds" List-Id: Cc: soc@kernel.org, linux-arm-kernel@lists.infradead.org, linux-kernel@vger.kernel.org Message-Id: <212ba952-faee-42f8-959d-c2a8d3dc89a7@app.fastmail.com> In-Reply-To: References: Subject: [GIT PULL 1/4] soc: devicetree updates for 6.12 The following changes since commit 47ac09b91befbb6a235ab620c32af719f8208399: Linux 6.11-rc4 (2024-08-18 13:17:27 -0700) are available in the Git repository at: https://git.kernel.org/pub/scm/linux/kernel/git/soc/soc.git tags/soc-dt-6.12 for you to fetch changes up to 168c3e0d443599dd370710243fbf5c815fad7890: Merge tag 'sunxi-dt-for-6.12-2' of https://git.kernel.org/pub/scm/linux/kernel/git/sunxi/linux into soc/dt (2024-09-12 14:25:36 +0000) ---------------------------------------------------------------- soc: devicetree updates for 6.12 New SoC support for Broadcom bcm2712 (Raspberry Pi 5) and Renesas R9A09G057 (RZ/V2H(P)) and Qualcomm Snapdragon 414 (MSM8929), all three of these are variants of already supported chips, in particular the last one is almost identical to MSM8939. Lots of updates to Mediatek, ASpeed, Rockchips, Amlogic, Qualcomm, STM32, NXP i.MX, Sophgo, TI K3, Renesas, Microchip at91, NVIDIA Tegra, and T-HEAD. The added Qualcomm platform support once again dominates the changes, with seven phones and three laptops getting added in addition to many new features on existing machines. The Snapdragon X1E support specifically keeps improving. The other new machines are: - eight new machines using various 64-bit Rockchips SoCs, both on the consumer/gaming side and developer boards - three industrial boards with 64-bit i.MX, which is a very low number for them. - four more servers using a 32-bit Speed BMC - three boards using STM32MP1 SoCs - one new machine each using allwinner, amlogic, broadcom and renesas chips. ---------------------------------------------------------------- Abel Vesa (2): arm64: dts: qcom: x1e80100: Add orientation-switch to all USB+DP QMP PHYs arm64: dts: qcom: x1e80100: Fix PHY for DP2 Adam Ford (1): arm64: dts: imx8mp-beacon: Enable DW HDMI Bridge Adam Słaboń (1): arm64: dts: qcom: msm8939-wingtech-wt82918: Add Lenovo Vibe K5 devices Ajit Pandey (4): dt-bindings: clock: qcom: add DISPCC clocks on SM4450 dt-bindings: clock: qcom: add CAMCC clocks on SM4450 dt-bindings: clock: qcom: add GPUCC clocks on SM4450 arm64: dts: qcom: sm4450: add camera, display and gpu clock controller Alessandro Zini (1): arm64: dts: ti: k3-am62: Enable CPU freq throttling on thermal alert Alex Bee (3): arm64: dts: rockchip: Add sdmmc_ext for RK3328 arm64: dts: rockchip: Add sdmmc/sdio/emmc reset controls for RK3328 ARM: dts: rockchip: Add vpu nodes for RK3128 Alex Zhao (1): arm64: dts: rockchip: rk3588s fix sdio pins to pull up Alexander Dahl (2): ARM: dts: microchip: sam9x60: Move i2c address/size to dtsi ARM: dts: microchip: sam9x60: Fix rtc/rtt clocks Alexander Reimelt (2): dt-bindings: arm: qcom: Add LG G4 (h815) arm64: dts: qcom: msm8992-lg-h815: Initial support for LG G4 (H815) Alexander Stein (11): arm64: dts: imx8-ss-dma: add #address-cells and #size-cells to LPI2C nodes arm64: dts: imx8-ss-dma: Fix adc0 closing brace location arm64: dts: imx8mm-tqma8mqml-mba8mx: Increase frequency for i2c busses arm64: dts: mba8mx: Add Ethernet PHY IRQ support arm64: dts: freescale: imx93-tqma9352: Add PMIC node arm64: dts: freescale: imx93-tqma9352: add eMMC regulators arm64: dts: freescale: imx93-tqma9352-mba93xxla: enable LPSPI6 interface arm64: dts: freescale: imx93-tqma9352-mba93xxla: add missing pad configurations arm64: dts: freescale: imx93-tqma9352-mba93xxla: Add ethernet aliases arm64: dts: freescale: imx93-tqma9352-mba93xxca: add missing pad configurations arm64: dts: freescale: imx93-tqma9352-mba93xxca: Add ethernet aliases Alexandre Mergnat (2): arm64: dts: mediatek: add afe support for mt8365 SoC arm64: dts: mediatek: add audio support for mt8365-evk Amit Pundir (1): arm64: dts: qcom: sm8550-hdk: add the Wifi node Andrea della Porta (1): arm64: dts: broadcom: Add minimal support for Raspberry Pi 5 Andrei Simion (5): ARM: dts: microchip: at91-sama7g5ek: Add reg_5v to supply PMIC nodes ARM: dts: microchip: at91-sama7g54_curiosity: Add reg_5v to supply PMIC nodes ARM: dts: microchip: at91-sama5d2_icp: Add reg_5v to supply PMIC nodes ARM: dts: microchip: at91-sama5d27_wlsom1: Add reg_5v to supply PMIC nodes ARM: dts: microchip: sama5d29_curiosity: Add reg_5v to supply PMIC nodes Andrei Stefanescu (1): arm64: dts: s32g: add the pinctrl node Andrej Picej (1): arm64: dts: imx8mp-phyboard-pollux: Disable write-protect on SD card Andrew Davis (8): dt-bindings: soc: ti: am654-serdes-ctrl: Add simple-mfd to compatible items arm64: dts: ti: k3-am65: Add simple-mfd compatible to SerDes control nodes arm64: dts: ti: k3-j721e-sk: Fix reversed C6x carveout locations arm64: dts: ti: k3-j721e-beagleboneai64: Fix reversed C6x carveout locations arm64: dts: ti: k3-am65: Include entire FSS region in ranges arm64: dts: ti: k3-j721e: Include entire FSS region in ranges arm64: dts: ti: k3-j721s2: Include entire FSS region in ranges arm64: dts: ti: k3-j784s4: Include entire FSS region in ranges Andrew Jeffery (7): ARM: dts: aspeed: Fix coprocessor interrupt controller node name ARM: dts: aspeed: Specify correct generic compatible for CVIC ARM: dts: aspeed: Specify required properties for sram node ARM: dts: aspeed: Remove undocumented XDMA nodes ARM: dts: aspeed: Clean up AST2500 pinctrl properties ARM: dts: aspeed-g6: Use generic 'ethernet' for ftgmac100 nodes ARM: dts: aspeed-g6: Drop cells properties from ethernet nodes André Apitzsch (4): arm64: dts: qcom: msm8916-longcheer-l8910: Add rear flash arm64: dts: qcom: msm8939-longcheer-l9100: Add rear flash arm64: dts: qcom: msm8939-longcheer-l9100: Add rear flash Revert "arm64: dts: qcom: msm8939-longcheer-l9100: Add rear flash" Andy Yan (2): dt-bindings: arm: rockchip: Add Cool Pi CM5 GenBook arm64: dts: rockchip: Add support for rk3588 based Cool Pi CM5 GenBook AngeloGioacchino Del Regno (4): arm64: dts: mediatek: mt8186: Fix supported-hw mask for GPU OPPs arm64: dts: mediatek: Add ADC node on MT6357, MT6358, MT6359 PMICs dt-bindings: clock: gcc-msm8998: Add Q6 and LPASS clocks definitions arm64: dts: qcom: msm8998: Add disabled support for LPASS iommu for Q6 Animesh Agarwal (1): arm64: dts: layerscape: remove unused num-viewport Ankit Sharma (1): arm64: dts: qcom: sa8775p: Add capacity and DPC properties Anton Bambura (1): arm64: dts: qcom: msm8916-wingtech-wt865x8: Add Lenovo A6000/A6010 Apurva Nandan (2): arm64: dts: ti: k3-j722s-main: Add R5F and C7x remote processor nodes arm64: dts: ti: k3-j722s-evm: Enable Inter-Processor Communication Arnd Bergmann (33): Merge tag 'thead-dt-for-v6.12' of https://github.com/pdp7/linux into soc/dt Merge tag 'renesas-dt-bindings-for-v6.12-tag1' of https://git.kernel.org/pub/scm/linux/kernel/git/geert/renesas-devel into soc/dt Merge tag 'renesas-dts-for-v6.12-tag1' of https://git.kernel.org/pub/scm/linux/kernel/git/geert/renesas-devel into soc/dt Merge tag 'samsung-dt64-6.12' of https://git.kernel.org/pub/scm/linux/kernel/git/krzk/linux into soc/dt Merge tag 'juno-update-6.12' of https://git.kernel.org/pub/scm/linux/kernel/git/sudeep.holla/linux into soc/dt Merge tag 'tegra-for-6.12-dt-bindings' of https://git.kernel.org/pub/scm/linux/kernel/git/tegra/linux into soc/dt Merge tag 'tegra-for-6.12-arm-dt' of https://git.kernel.org/pub/scm/linux/kernel/git/tegra/linux into soc/dt Merge tag 'tegra-for-6.12-arm64-dt' of https://git.kernel.org/pub/scm/linux/kernel/git/tegra/linux into soc/dt Merge tag 'at91-dt-6.12' of https://git.kernel.org/pub/scm/linux/kernel/git/at91/linux into soc/dt Merge tag 'v6.12-rockchip-dts64-1' of https://git.kernel.org/pub/scm/linux/kernel/git/mmind/linux-rockchip into soc/dt Merge tag 'v6.12-rockchip-dts32-1' of https://git.kernel.org/pub/scm/linux/kernel/git/mmind/linux-rockchip into soc/dt Merge tag 'renesas-dts-for-v6.12-tag2' of https://git.kernel.org/pub/scm/linux/kernel/git/geert/renesas-devel into soc/dt Merge tag 'ti-k3-dt-for-v6.12' of https://git.kernel.org/pub/scm/linux/kernel/git/ti/linux into soc/dt Merge tag 'riscv-sophgo-dt-for-6.12' of https://github.com/sophgo/linux into soc/dt Merge tag 'imx-bindings-6.12' of https://git.kernel.org/pub/scm/linux/kernel/git/shawnguo/linux into soc/dt Merge tag 'imx-dt-6.12' of https://git.kernel.org/pub/scm/linux/kernel/git/shawnguo/linux into soc/dt Merge tag 'imx-dt64-6.12' of https://git.kernel.org/pub/scm/linux/kernel/git/shawnguo/linux into soc/dt Merge tag 'omap-for-v6.12/dt-signed' of https://git.kernel.org/pub/scm/linux/kernel/git/khilman/linux-omap into soc/dt Merge tag 'stm32-dt-for-v6.12-1' of https://git.kernel.org/pub/scm/linux/kernel/git/atorgue/stm32 into soc/dt Merge tag 'qcom-arm32-for-6.12' of https://git.kernel.org/pub/scm/linux/kernel/git/qcom/linux into soc/dt Merge tag 'qcom-arm64-for-6.12' of https://git.kernel.org/pub/scm/linux/kernel/git/qcom/linux into soc/dt Merge tag 'amlogic-arm-dt-for-v6.11' of https://git.kernel.org/pub/scm/linux/kernel/git/amlogic/linux into soc/dt Merge tag 'amlogic-arm64-dt-for-v6.12' of https://git.kernel.org/pub/scm/linux/kernel/git/amlogic/linux into soc/dt Merge tag 'sunxi-dt-for-6.12' of https://git.kernel.org/pub/scm/linux/kernel/git/sunxi/linux into soc/dt Merge tag 'dt64-cleanup-6.12' of https://git.kernel.org/pub/scm/linux/kernel/git/krzk/linux-dt into soc/dt Merge tag 'dt-cleanup-6.12' of https://git.kernel.org/pub/scm/linux/kernel/git/krzk/linux-dt into soc/dt Merge tag 'arm-soc/for-6.12/devicetree' of https://github.com/Broadcom/stblinux into soc/dt Merge tag 'v6.12-rockchip-dts64-2' of https://git.kernel.org/pub/scm/linux/kernel/git/mmind/linux-rockchip into soc/dt Merge tag 'v6.12-rockchip-dts32-2' of https://git.kernel.org/pub/scm/linux/kernel/git/mmind/linux-rockchip into soc/dt Merge tag 'aspeed-6.12-devicetree' of https://git.kernel.org/pub/scm/linux/kernel/git/joel/bmc into soc/dt Merge tag 'v6.11-next-dts64' of https://git.kernel.org/pub/scm/linux/kernel/git/mediatek/linux into soc/dt Merge tag 'arm-soc/for-6.12/devicetree-arm64' of https://github.com/Broadcom/stblinux into soc/dt Merge tag 'sunxi-dt-for-6.12-2' of https://git.kernel.org/pub/scm/linux/kernel/git/sunxi/linux into soc/dt Artur Weber (2): ARM: dts: broadcom: bcm21664: Move chosen node into Garnet DTS ARM: dts: bcm-mobile: Split out nodes used by both BCM21664 and BCM23550 Aurelien Jarno (1): arm64: dts: rockchip: add DT entry for RNG to RK356x Barnabás Czémán (2): arm64: dts: qcom: pm8950: Add resin node arm64: dts: qcom: msm8976: Add restart node Bartosz Golaszewski (4): arm64: dts: qcom: sm8650-qrd: use the PMU to power up bluetooth arm64: dts: qcom: sa8775p-ride: enable remoteprocs arm64: dts: qcom: sa8775p: add CPU idle states arm64: dts: qcom: sa8775p: fix the fastrpc label Beleswar Padhi (14): arm64: dts: ti: k3-j7200-som-p0: Switch MAIN R5F cluster to Split-mode arm64: dts: ti: k3-j721e-som-p0: Switch MAIN R5F clusters to Split-mode arm64: dts: ti: k3-j721e-sk: Switch MAIN R5F clusters to Split-mode arm64: dts: ti: k3-j721s2-som-p0: Switch MAIN R5F clusters to Split-mode arm64: dts: ti: k3-am68-sk-som: Switch MAIN R5F clusters to Split-mode arm64: dts: ti: k3-j784s4-evm: Switch MAIN R5F clusters to Split-mode arm64: dts: ti: k3-am69-sk: Switch MAIN R5F clusters to Split-mode arm64: dts: ti: k3-j7200-som-p0: Change timer nodes status to reserved arm64: dts: ti: k3-j721e-som-p0: Change timer nodes status to reserved arm64: dts: ti: k3-j721e-sk: Change timer nodes status to reserved arm64: dts: ti: k3-j721s2-som-p0: Change timer nodes status to reserved arm64: dts: ti: k3-am68-sk-som: Change timer nodes status to reserved arm64: dts: ti: k3-j784s4-evm: Change timer nodes status to reserved arm64: dts: ti: k3-am69-sk: Change timer nodes status to reserved Benjamin Hahn (3): arm64: dts: freescale: imx8mp-phycore: Add no-eth overlay arm64: dts: freescale: imx8mp-phyboard-pollux: Add and enable TPM arm64: dts: imx8mp-phyboard-pollux-rdk: Add support for PCIe Bhavya Kapoor (5): arm64: dts: ti: k3-j721s2-som-p0: Update mux-controller node name arm64: dts: ti: k3-j7200-som-p0: Update mux-controller node name arm64: dts: ti: k3-am68-sk-base-board: Add clklb pin mux for mmc1 arm64: dts: ti: k3-j722s-evm: Describe main_uart5 arm64: dts: ti: k3-j722s-evm: Add support for multiple CAN instances Biju Das (7): arm64: dts: renesas: r9a07g0{43,44,54}: Move regulator-vbus device node arm64: dts: renesas: r9a07g043u: Add FCPVD node arm64: dts: renesas: r9a07g043u: Add VSPD node arm64: dts: renesas: r9a07g043u: Add DU node arm64: dts: renesas: rzg2l-smarc: Enable HDMI audio arm64: dts: renesas: rzg2lc-smarc: Enable HDMI audio arm64: dts: renesas: r9a07g043u11-smarc: Enable DU Bingwu Zhang (1): ARM: dts: qcom: msm8974pro-samsung-klte: Add pstore node Bjorn Andersson (14): Merge branch 'arm64-fixes-for-6.11' into HEAD dt-bindings: clock: qcom: Add missing USB MP resets Merge branch '20240730-sc8180x-usb-mp-v2-1-a7dc4265b553@quicinc.com' into arm64-for-6.12 arm64: dts: qcom: sc8180x-pmics: Add second PMC8180 GPIO arm64: dts: qcom: sc8180x: Align USB nodes with binding arm64: dts: qcom: sc8180x: Add USB MP controller and phys arm64: dts: qcom: sc8180x-primus: Enable the two MP USB ports arm64: dts: qcom: sc8180x-lenovo-flex-5g: Enable USB multiport controller Merge branch '20240731062916.2680823-7-quic_skakitap@quicinc.com' into arm64-for-6.12 Merge branch '20240717-dispcc-sm8550-fixes-v2-7-5c4a3128c40b@linaro.org' into arm64-for-6.12 arm64: dts: qcom: sc8180x: Enable the power key Merge branch '20240611133752.2192401-1-quic_ajipan@quicinc.com' into arm64-for-6.12 Merge branch '20240814-lpass-v1-1-a5bb8f9dfa8b@freebox.fr' into arm64-for-6.12 Merge branch '20240730054817.1915652-2-quic_varada@quicinc.com' into arm64-for-6.12 Bryan O'Donoghue (1): arm64: dts: qcom: sc8280xp-x13s: Enable RGB sensor Chanh Nguyen (5): ARM: dts: aspeed: mtjade, mtmitchell: Add OCP temperature sensors ARM: dts: aspeed: mtmitchell: Add I2C temperature sensor alias ports ARM: dts: aspeed: mtmitchell: Add Riser cards ARM: dts: aspeed: mtmitchell: Enable i2c10 and i2c15 ARM: dts: aspeed: mtmitchell: Add LEDs Chen Wang (2): riscv: sophgo: dts: add mmc controllers for SG2042 SoC riscv: sophgo: dts: add gpio controllers for SG2042 SoC Chen-Yu Tsai (7): arm64: dts: mediatek: mt8183-kukui-jacuzzi: Simplify DSI endpoint replacement arm64: dts: mediatek: mt8195-cherry: Mark USB 3.0 on xhci1 as disabled arm64: dts: mediatek: mt8395-nio-12l: Mark USB 3.0 on xhci1 as disabled arm64: dts: mediatek: mt8195: Assign USB 3.0 PHY to xhci1 by default arm64: dts: mt8183-kukui: clean up regulator tree arm64: dts: mediatek: mt8195: Correct clock order for dp_intf* arm64: dts: mediatek: mt8186-corsola: Disable DPI display interface Chris Morgan (7): dt-bindings: arm: sunxi: Add Anbernic RG35XXSP arm64: dts: allwinner: h616: Add r_i2c pinctrl nodes arm64: dts: allwinner: h616: Change RG35XX Series from r_rsb to r_i2c arm64: dts: allwinner: h700: Add Anbernic RG35XX-SP arm64: dts: allwinner: h700: Add charger for Anbernic RG35XX dt-bindings: arm: rockchip: Add GameForce Ace arm64: dts: rockchip: Add GameForce Ace Christopher Obbard (3): dt-bindings: arm: rockchip: Add Firefly Core-PX30-JD4 on baseboard arm64: dts: rockchip: add Firefly Core-PX30-JD4 SoM arm64: dts: rockchip: add Firefly JD4 baseboard with Core-PX30-JD4 SoM Chukun Pan (4): arm64: dts: rockchip: use generic Ethernet PHY reset bindings for Lunzn Fastrhino R68S arm64: dts: rockchip: remove useless tx/rx_delay for Lunzn Fastrhino R68S arm64: dts: rockchip: Enable UHS-I SDR-50 for Lunzn FastRhino R66S arm64: dts: rockchip: disable display subsystem only for Radxa E25 Ciprian Costea (1): arm64: dts: s32g: Disable usdhc write-protect Clark Wang (2): arm64: dts: imx8-ss-dma: enable dma support for lpspi arm64: dts: imx93: add lpi2c1 and st lsm6dso node Claudiu Beznea (6): arm64: dts: renesas: r9a08g045: Add DMAC node ARM: dts: microchip: at91-sama7g5ek: add EEPROMs arm64: dts: renesas: r9a08g045: Add I2C nodes arm64: dts: renesas: rzg3s-smarc: Enable I2C0 node arm64: dts: renesas: rzg3s-smarc-som: Enable I2C1 node ARM: dts: microchip: sama7g5: Fix RTT clock Colin Foster (1): ARM: dts: am335x-bone-common: Increase MDIO reset deassert time Conor Dooley (1): arm64: dts: imx8: remove non-existent DACs Dang Huynh (11): arm64: dts: qcom: sm6115-pro1x: Add Hall Switch and Camera Button arm64: dts: qcom: sm6115-pro1x: Add PCA9534 IO Expander arm64: dts: qcom: sm6115-pro1x: Add Goodix Touchscreen arm64: dts: qcom: sm6115-pro1x: Add Caps Lock LED arm64: dts: qcom: sm6115-pro1x: Enable SD card slot arm64: dts: qcom: sm6115-pro1x: Enable MDSS and GPU arm64: dts: qcom: sm6115-pro1x: Hook up USB3 SS arm64: dts: qcom: sm6115-pro1x: Add PMI632 Type-C property arm64: dts: qcom: sm6115-pro1x: Enable RGB LED arm64: dts: qcom: sm6115-pro1x: Enable remoteprocs arm64: dts: qcom: sm6115-pro1x: Enable ATH10K WLAN Danila Tikhonov (1): arm64: dts: qcom: sm7125-xiaomi-common: Add reset-gpios for ufs_mem_hc Dara Stotland (7): arm64: tegra: Add common nodes to AGX Orin module arm64: tegra: Combine AGX Orin board files arm64: tegra: Combine IGX Orin board files arm64: tegra: Move AGX Orin nodes to correct location arm64: tegra: Move padctl supply nodes to AGX Orin module arm64: tegra: Move BPMP nodes to AGX Orin module arm64: tegra: Add thermal nodes to AGX Orin SKU8 David Heidelberg (1): dt-bindings: arm: tegra: Document Nyan, all revisions in kernel tree David Jander (3): ARM: dts: stm32: Add MECIO1 and MECT1S board variants arm64: dts: rockchip: add CAN-FD controller nodes to rk3568 arm64: dts: rockchip: add CAN0 and CAN1 interfaces to mecsbc board David Virag (4): arm64: dts: exynos: exynos7885-jackpotlte: Correct RAM amount to 4GB dt-bindings: clock: exynos7885: Fix duplicated binding dt-bindings: clock: exynos7885: Add CMU_TOP PLL MUX indices dt-bindings: clock: exynos7885: Add indices for USB clocks Debbie Martin (1): arm64: dts: fvp: Set stdout-path to serial0 in the chosen node Devarsh Thakkar (1): arm64: dts: ti: k3-am62a: Add E5010 JPEG Encoder Diederik de Haas (1): arm64: dts: rockchip: Add missing tshut props to tsadc on quartz64-b Diogo Ivo (3): arm64: tegra: Fix gpio for P2597 vmmc regulator arm64: tegra: Add wp-gpio for P2597's external card slot arm64: dts: ti: iot2050: Declare Ethernet PHY leds Dmitry Baryshkov (5): dt-bindings: clock: qcom,sm8650-dispcc: replace with symlink ARM: dts: qcom: add generic compat string to RPM glink channels arm64: dts: qcom: add generic compat string to RPM glink channels arm64: dts: qcom: sm8350: add MDSS registers interconnect arm64: dts: qcom: sm8350: add refgen regulator Dominik Haller (1): ARM: dts: ti: omap: am335x-wega: Fix audio clock provider Dragan Simic (4): arm64: dts: rockchip: Correct the Pinebook Pro battery design capacity arm64: dts: rockchip: Move RK3399 OPPs to dtsi files for SoC variants arm64: dts: rockchip: Raise Pinebook Pro's panel backlight PWM frequency arm64: dts: allwinner: a64: Add GPU thermal trips to the SoC dtsi Drew Fustini (6): riscv: dts: thead: Add TH1520 AP_SUBSYS clock controller riscv: dts: thead: change TH1520 uart nodes to use clock controller riscv: dts: thead: change TH1520 mmc nodes to use clock controller riscv: dts: thead: update TH1520 dma and timer nodes to use clock controller riscv: dts: thead: add clock to TH1520 gpio nodes riscv: dts: thead: change TH1520 SPI node to use clock controller Duy Nguyen (1): arm64: dts: renesas: r8a779h0: Add CAN-FD node Eddie James (5): dt-bindings: arm: aspeed: add IBM P11 BMC boards ARM: dts: aspeed: Add IBM P11 FSI devices ARM: dts: aspeed: Add IBM P11 Blueridge BMC system ARM: dts: aspeed: Add IBM P11 Blueridge 4U BMC system ARM: dts: aspeed: Add IBM P11 Fuji BMC system Elinor Montmasson (2): ARM: dts: imx6: update spdif sound card node properties arm64: dts: imx8m: update spdif sound card node properties Emanuele Ghidoli (1): arm64: dts: colibri-imx8x: Add usb support Emmanuel Gil Peyrot (1): arm64: dts: rockchip: Add VEPU121 to RK3588 Eric Chanudet (1): arm64: dts: ti: k3-j784s4-main: Align watchdog clocks FUKAUMI Naoki (4): arm64: dts: rockchip: drop dr_mode for Radxa ZERO 3W/3E arm64: dts: rockchip: remove unnecessary properties for Radxa ROCK 5A arm64: dts: rockchip: enable PCIe on M.2 E key for Radxa ROCK 5A arm64: dts: rockchip: remove duplicate nodes from dts for ROCK 4SE Fabio Estevam (10): ARM: dts: imx6sx-udoo-neo: Properly configure ENET_REF arm64: dts: imx8mm-phygate-tauri-l: Remove compatible from dtso arm64: dts: imx8mm-venice-gw72xx-0x: Remove compatible from dtso ARM: dts: imx1/imx27: Use dma-controller as node name arm64: dts: imx8mm/n-beacon-kit: Fix the order of ADV7535 reg entries arm64: dts: imx93-tqma9352-mba93: Fix USB hub node name ARM: dts: rockchip: Do not describe unexisting DAC device on rv1108-elgin-r1 ARM: dts: imx28-apx4devkit: Fix the regulator description ARM: dts: imx23/8: Rename apbh and apbx nodes ARM: dts: imx28-tx28: Fix the fsl,saif-master usage Faiz Abbas (1): arm64: dts: ti: k3-am654-idk: Add Support for MCAN Fei Shao (1): arm64: dts: mediatek: mt8186-corsola: Update ADSP reserved memory region Florian Klink (1): arm64: dts: rockchip: add rfkill node for M.2 E wifi on orangepi-5-plus Francesco Dolcini (3): arm64: dts: colibri-imx8x: Add fxl6408 gpio expander arm64: dts: colibri-imx8x: Add PMIC thermal zone arm64: dts: colibri-imx8x: Add USB3803 HUB Frank Li (43): arm64: dts: imx95: add edma[1..3] nodes arm64: dts: imx95: add sai[1..6], xcvr and micfill arm64: dts: imx95-19x19-evk: Add audio related nodes arm64: dts: imx95: add flexspi node arm64: dts: imx95-19x19-evk: add flexspi and child node arm64: dts: imx95: add thermal_zone label arm64: dts: imx95-19x19-evk: add pwm fan control arm64: dts: layerscape: rename aux-bus to bus arm64: dts: layerscape: rename rcpm as wakeup-control from power-control arm64: dts: layerscape: use common pcs-handle property arm64: dts: fsl-ls1043a: change uqe to uqe-bus and remove #address-cells arm64: dts: fsl-ls1028a: add fsl,ls1028-reset for syscon arm64: dts: layerscape: add msi-cell = <1> for gic its arm64: dts: layerscape: remove big-endian for mmc nodes arm64: dts: fsl-ls1046a: remove big-endian at memory-controller arm64: dts: layerscape: remove undocumented fsl,ls-pcie-ep arm64: dts: fsl,ls2085a: remove fsl,ls2085a-pcie arm64: dts: fsl-ls1028a: remove undocumented 'little-endian' for dspi node arm64: dts: fsl-ls208xa: move reboot node under syscon arm64: dts: imx8mm-venice-gw7901: add #address(size)-cells for gsc@20 arm64: dts: imx8mp-data-modul-edm-sbc: remove #clock-cells for sai3 arm64: dts: imx8mp-venice-gw74xx-imx219: remove compatible in overlay file dt-bindings: arm: fsl: add fsl-ls2081a-rdb board arm64: dts: imx8-ss-img: remove undocument slot for jpeg arm64: dts: fsl-ls1043a: move "fsl,ls1043a-qdma" ahead "fsl,ls1021a-qdma" arm64: dts: fsl-ls1012a-frdm: move clock-sc16is7xx under root node arm64: dts: layerscape: rename mdio-mux-emi to mdio-mux@ arm64: dts: fsl-ls1028: add missed supply for wm8904 arm64: dts: imx8mm-venice-gw7902(3): add #address-cells for gsc@20 arm64: dts: fsl-lx2160a-tqmlx2160a: change "vcc" to "vdd" for hub* arm64: dts: imx8mp-venice: add vddl and vana for sensor@10 arm64: dts: fsl-ls1088a-ten64: change to low case hex value arm64: dts: s32v234: remove fallback compatible string arm,cortex-a9-gic arm64: dts: imx8mm-beacon-kit: add DVDD-supply and DOVDD-supply arm64: dts: imx8: add basic lvds0 and lvds1 subsystem arm64: dts: imx8qm: add lvds subsystem arm64: dts: imx8: add basic mipi subsystem arm64: dts: imx8qm: add mipi subsystem arm64: dts: imx8qm-mek: add cm4 remote-proc and related memory region arm64: dts: imx8qm-mek: add pwm and i2c in lvds subsystem arm64: dts: imx8qm-mek: add i2c in mipi[0,1] subsystem arm64: dts: imx8qm-mek: add usb 3.0 and related type C nodes arm64: dts: imx: rename gpio hog as -hog Frieder Schrempf (2): dt-bindings: arm: fsl: Add Kontron i.MX93 OSM-S based boards arm64: dts: Add support for Kontron i.MX93 OSM-S SoM and BL carrier board Geert Uytterhoeven (16): arm64: dts: renesas: r8a774a1: Add missing iommus properties arm64: dts: renesas: r8a774b1: Add missing iommus properties arm64: dts: renesas: r8a774c0: Add missing iommus properties arm64: dts: renesas: r8a774e1: Add missing iommus properties arm64: dts: renesas: r8a77960: Add missing iommus properties arm64: dts: renesas: r8a77961: Add missing iommus properties arm64: dts: renesas: r8a77965: Add missing iommus properties arm64: dts: renesas: r8a77970: Add missing iommus property arm64: dts: renesas: r8a77980: Add missing iommus properties arm64: dts: renesas: r8a779a0: Add missing iommus properties arm64: dts: renesas: r8a779g0: Add missing iommus properties arm64: dts: renesas: r8a779h0: Add missing iommus properties arm64: dts: renesas: gray-hawk-single: Add push switches arm64: dts: renesas: gray-hawk-single: Add GP LEDs arm64: dts: renesas: gray-hawk-single: Add CAN-FD support Merge tag 'renesas-r9a09g057-dt-binding-defs-tag' into renesas-dts-for-v6.12 Haibo Chen (1): arm64: dts: imx95: add flexcan[1..5] support Heiko Stuebner (22): ARM: dts: rockchip: use constant for HCLK_SFC on rk3128 arm64: dts: rockchip: add PCIe supply regulator to Qnap-TS433 arm64: dts: rockchip: enable second PCIe controller on the Qnap-TS433 arm64: dts: rockchip: enable uart0 on Qnap-TS433 arm64: dts: rockchip: enable usb ports on Qnap-TS433 arm64: dts: rockchip: add stdout path on Qnap-TS433 arm64: dts: rockchip: enable sata1+2 on Qnap-TS433 arm64: dts: rockchip: add board-aliases for Qnap-TS433 arm64: dts: rockchip: add hdd leds to Qnap-TS433 arm64: dts: rockchip: enable the tsadc on the Qnap-TS433 arm64: dts: rockchip: add gpio-keys to Qnap-TS433 arm64: dts: rockchip: define cpu-supply on the Qnap-TS433 arm64: dts: rockchip: add missing pmic information on Qnap-TS433 arm64: dts: rockchip: enable gpu on Qnap-TS433 arm64: dts: rockchip: add 2 pmu_io_domain supplies for Qnap-TS433 arm64: dts: rockchip: actually enable pmu-io-domains on qnap-ts433 arm64: dts: rockchip: add product-data eeproms to QNAP TS433 arm64: dts: rockchip: drop obsolete reset-names from rk356x rng node arm64: dts: rockchip: use correct fcs,suspend-voltage-selector on NanoPC-T6 arm64: dts: rockchip: drop unsupported regulator property from NanoPC-T6 arm64: dts: rockchip: drop unsupported regulator-property from NanoPC-T6 arm64: dts: rockchip: drop hp-pin-name property from audio card on nanopc-t6 Huqiang Qin (1): arm64: dts: amlogic: add watchdog node for A4 SoCs Inochi Amaoto (5): riscv: dts: sophgo: cv18xx: add DMA controller riscv: dts: sophgo: Add sdhci0 configuration for Huashan Pi riscv: dts: sophgo: Use common "interrupt-parent" for all peripherals for sg2042 riscv: dts: sophgo: Add i2c device support for sg2042 riscv: dts: sophgo: Add mcu device for Milk-V Pioneer Jacky Huang (3): arm64: dts: nuvoton: Add syscon to the system-management node arm64: dts: nuvoton: ma35d1: Add pinctrl and gpio nodes arm64: dts: nuvoton: ma35d1: Add uart pinctrl settings Jan Kiszka (2): arm64: dts: ti: k3-am642-evm: Silence schema warning arm64: dts: ti: iot2050: Add overlays for M.2 used by firmware Jared McArthur (2): arm64: dts: ti: k3-am62p: Add gpio-reserved-ranges for main_gpio1 arm64: dts: ti: k3-j722s: Add gpio-reserved-ranges for main_gpio1 Jianfeng Liu (2): arm64: dts: rockchip: Add VPU121 support for RK3588 arm64: dts: rockchip: Add RGA2 support to rk3588 Johan Hovold (6): arm64: dts: qcom: sc8280xp-crd: disable PCIe perst pull downs arm64: dts: qcom: sc8280xp-crd: clean up PCIe2a pinctrl node arm64: dts: qcom: sc8280xp-x13s: disable PCIe perst pull downs arm64: dts: qcom: sc8280xp-x13s: clean up PCIe2a pinctrl node arm64: dts: qcom: x1e80100: add PCIe5 nodes arm64: dts: qcom: x1e80100-crd: enable SDX65 modem Jon Hunter (1): arm64: tegra: Correct location of power-sensors for IGX Orin Jonas Karlman (6): dt-bindings: arm: rockchip: Correct vendor for Hardkernel ODROID-M1 arm64: dts: rockchip: Correct vendor prefix for Hardkernel ODROID-M1 dt-bindings: arm: rockchip: Add Hardkernel ODROID-M1S arm64: dts: rockchip: Add Hardkernel ODROID-M1S dt-bindings: arm: rockchip: Add Hardkernel ODROID-M2 arm64: dts: rockchip: Add Hardkernel ODROID-M2 Jonathan Liu (1): arm64: dts: rockchip: Enable RK809 audio codec for Radxa ROCK 4C+ Joy Zou (1): arm64: dts: ls1088ardb: add new RTC PCF2131 support João Paulo Gonçalves (6): arm64: dts: imx8mp-verdin: add HDMI audio support arm64: dts: colibri-imx8x: Add analog inputs arm64: dts: colibri-imx8x: Add sound card arm64: dts: colibri-imx8x: Add vpu support arm64: dts: colibri-imx8x: Add adma_pwm arm64: dts: colibri-imx8x: Cleanup comments Judith Mendez (5): arm64: dts: ti: k3-am62p: Fix ESM interrupt sources arm64: dts: ti: k3-am62: Add comments to ESM nodes arm64: dts: ti: k3-am62a: Add ESM nodes arm64: dts: ti: k3-am64: Add more ESM interrupt sources arm64: dts: ti: k3-am65: Add ESM nodes Junhao Xie (3): dt-bindings: vendor-prefixes: Add Shenzhen JLC Technology Group LCKFB dt-bindings: arm: rockchip: Add LCKFB Taishan Pi RK3566 arm64: dts: rockchip: add dts for LCKFB Taishan Pi RK3566 Kanak Shilledar (1): riscv: dts: thead: add basic spi node Karthikeyan Krishnasamy (3): ARM: dts: rockchip: Add i2c3 node for RV1126 ARM: dts: rockchip: Add i2s0 node for RV1126 ARM: dts: rockchip: Add pwm node for RV1126 Khanh Le (1): arm64: dts: renesas: r8a779h0: Add PWM device nodes Konrad Dybcio (9): arm64: dts: qcom: x1e80100: Fix up hex style arm64: dts: qcom: x1e80100: Disable SMB2360_2 by default arm64: dts: qcom: x1e80100: Add USB Multiport controller dt-bindings: arm: qcom: Add Surface Laptop 7 devices arm64: dts: qcom: x1e80100-pmics: Add PMC8380C PWM arm64: dts: qcom: x1e80100: Add UART2 arm64: dts: qcom: Add support for X1-based Surface Laptop 7 devices dt-bindings: arm: qcom: Add Lenovo ThinkPad T14s Gen 6 arm64: dts: qcom: Add X1E78100 ThinkPad T14s Gen 6 Krishna Kurapati (1): arm64: dts: qcom: sa8295p-adp: Enable the four USB Type-A ports Kryštof Černý (2): arm64: dts: allwinner: h5: NanoPi Neo Plus2: Fix regulators arm64: dts: allwinner: h5: NanoPi NEO Plus2: Use regulators for pio Krzysztof Kozlowski (19): ARM: dts: amlogic: meson8b-ec100: align GPIO keys node name with bindings dt-bindings: soc: bcm: document brcm,bcm2711-avs-monitor ARM: dts: microchip: at91: align LED node name with bindings ARM: dts: nuvoton: wpcm450: align LED and GPIO keys node name with bindings arm64: dts: qcom: sm8150-mtp: drop incorrect amd,imageon Merge branch 'for-v6.12/clk-dt-bindings' into next/dt64 Merge branch 'for-v6.12/clk-dt-bindings' into next/dt64 MAINTAINERS: correct TQ Systems DTS patterns ARM: dts: imx7d-zii-rmu2: fix Ethernet PHY pinctrl property ARM: dts: imx7: align pin config nodes with bindings ARM: dts: imx7d-sdb: align pin config nodes with bindings dt-bindings: arm: fsl: drop usage of VAR-SOM-MX8MM SoM compatible alone ARM: dts: imx6ul-geam: fix fsl,pins property in tscgrp pinctrl ARM: dts: imx6ull-seeed-npi: fix fsl,pins property in tscgrp pinctrl ARM: dts: imx6ul-tx6ul: drop empty pinctrl placeholder ARM: dts: imx6ul: align pin config nodes with bindings ARM: dts: imx6sl: align pin config nodes with bindings ARM: dts: imx6qdl: align pin config nodes with bindings arm64: dts: imx8mm-var-som: drop unused top-level compatible Kuninori Morimoto (1): arm64: dts: renesas: gray-hawk-single: Add Sound support Kwanghoon Son (3): dt-bindings: clock: exynosautov9: add dpum clock arm64: dts: exynosautov9: add dpum clock DT nodes arm64: dts: exynosautov9: Add dpum SysMMU Lad Prabhakar (14): arm64: dts: renesas: r9a08g045: Correct GICD and GICR sizes arm64: dts: renesas: r9a07g043u: Correct GICD and GICR sizes arm64: dts: renesas: r9a07g054: Correct GICD and GICR sizes arm64: dts: renesas: r9a07g044: Correct GICD and GICR sizes dt-bindings: clock: renesas: Document RZ/V2H(P) SoC CPG dt-bindings: soc: renesas: Document RZ/V2H EVK board arm64: dts: renesas: Add initial SoC DTSI for RZ/V2H(P) SoC arm64: dts: renesas: Add initial DTS for RZ/V2H EVK board arm64: dts: renesas: r9a09g057: Add OSTM0-OSTM7 nodes arm64: dts: renesas: r9a09g057: Add RIIC0-RIIC8 nodes arm64: dts: renesas: r9a09g057: Add SDHI0-SDHI2 nodes arm64: dts: renesas: r9a09g057: Add WDT0-WDT3 nodes arm64: dts: renesas: r9a09g057h44-rzv2h-evk: Enable OSTM, I2C, and SDHI arm64: dts: renesas: r9a09g057h44-rzv2h-evk: Enable watchdog Laurent Pinchart (1): arm64: dts: imx8mp: Clarify csis clock frequency Li Hua Qian (1): arm64: dts: ti: iot2050: Disable lock-step for all iot2050 boards Lin, Meng-Bo (3): arm64: dts: qcom: msm8916-samsung-grandmax: Add touchscreen dt-bindings: qcom: Document samsung,j3ltetw arm64: dts: qcom: msm8916-samsung-j3ltetw: Add initial device tree Ling Xu (1): arm64: qcom: sa8775p: Add ADSP and CDSP0 fastrpc nodes Liu Ying (4): ARM: dts: imx53-qsb-hdmi: Do not disable TVE ARM: dts: imx53-qsb-hdmi: Merge display0 node arm64: dts: imx8mp-evk: Add native HDMI output arm64: dts: imx93-11x11-evk: Add PWM backlight for "LVDS" connector Logan Bristol (1): arm64: dts: ti: k3-am64*: Disable ethernet by default at SoC level Luca Weiss (3): ARM: dts: qcom: msm8226: Add CPU frequency scaling support ARM: dts: qcom: msm8226: Hook up CPU cooling ARM: dts: qcom: msm8226: Convert APCS usages to mbox interface Lukasz Majewski (3): ARM: dts: imx28-lwe: Fix partitions definitions ARM: dts: imx28-lwe: Reduce maximal SPI frequency ARM: dts: imx28-lwe: Remove saif[01] definitions MD Danish Anwar (1): arm64: dts: ti: k3-am654-idk: Fix dtbs_check warning in ICSSG dmas Manikandan Muralidharan (4): ARM: dts: microchip: change to simple-mfd from simple-bus for PIO3 pinumux controller ARM: dts: microchip: Remove additional compatible string from PIO3 pinctrl nodes ARM: dts: microchip: sam9x60: Remove additional compatible string from GPIO node dt-bindings: pinctrl: Convert Atmel PIO3 pinctrl to json-schema Marcel Ziswiler (1): arm64: dts: imx8mp-verdin: drop limit to sdio wi-fi frequency to 100 mhz Marcin Juszkiewicz (9): dt-bindings: arm: rockchip: Add NanoPC-T6 LTS arm64: dts: rockchip: prepare NanoPC-T6 for LTS board arm64: dts: rockchip: move NanoPC-T6 parts to DTS arm64: dts: rockchip: add NanoPC-T6 LTS arm64: dts: rockchip: add SPI flash on NanoPC-T6 arm64: dts: rockchip: add IR-receiver to NanoPC-T6 arm64: dts: rockchip: enable GPU on NanoPC-T6 arm64: dts: rockchip: enable USB-C on NanoPC-T6 arm64: dts: rockchip: add Mask Rom key on NanoPC-T6 Marek Vasut (10): arm64: dts: apm: storm: Rename menetphy@3 to ethernet-phy@3 arm64: dts: imx8mp: Enable HDMI to Data Modul i.MX8M Plus eDM SBC arm64: dts: imx8mm: Update Data Modul i.MX8M Mini eDM SBC DT to rev.A01 ARM: dts: stm32: Keep MDIO bus in AF across suspend DH STM32MP13xx DHCOR DHSBC board ARM: dts: stm32: Disable PHY clock output on DH STM32MP13xx DHCOR DHSBC board ARM: dts: stm32: Add ethernet MAC nvmem cells to DH STM32MP13xx DHCOR DHSBC board ARM: dts: stm32: Describe PHY LEDs in DH STM32MP13xx DHCOR DHSBC board DT ARM: dts: stm32: Sort properties in audio endpoints on STM32MP15xx DHCOM PDK2 ARM: dts: stm32: Switch bitclock/frame-master to flag on STM32MP15xx DHCOM PDK2 ARM: dts: stm32: Use SAI to generate bit and frame clock on STM32MP15xx DHCOM PDK2 Markus Niebel (14): arm64: dts: freescale: imx93-tqma9352: improve pad configuration ARM: dts: imx7-mba7: add iio-hwmon support ARM: dts: imx7-mba7: improve compatible for LM75 temp sensor ARM: dts: imx6qdl-tqma6: move i2c3 pinmux to imx6qdl-tqma6b ARM: dts: imx6qdl-tqma6: improve compatible for LM75 temp sensor ARM: dts: imx6qdl-mba6: improve compatible for LM75 temp sensor ARM: dts: imx6qdl-mba6b: remove doubled entry for I2C1 pinmux arm64: dts: freescale: imx93-tqma9352-mba93xxla: improve pad configuration arm64: dts: freescale: imx93-tqma9352-mba93xxla: add irq for temp sensor arm64: dts: freescale: imx93-tqma9352-mba93xxla: add GPIO line names arm64: dts: freescale: imx93-tqma9352-mba93xxca: add RTC / temp sensor IRQ arm64: dts: freescale: imx93-tqma9352-mba93xxca: improve pad configuration arm64: dts: freescale: imx93-tqma9352-mba93xxca: add GPIO line names arm64: dts: freescale: imx93-tqma9352: set SION for cmd and data pad of USDHC Matthias Schiffer (1): arm64: dts: ti: k3-am642-tqma64xxl-mbax4xxl: add PRU Ethernet support Max Merchel (1): dt-bindings: arm: fsl: correct spelling of TQ-Systems Michael Riesch (1): arm64: dts: rockchip: add wolfvision pf5 visualizer display Naina Mehta (3): arm64: dts: qcom: sdx75: update reserved memory regions for mpss arm64: dts: qcom: sdx75: Add remoteproc node arm64: dts: qcom: sdx75-idp: enable MPSS remoteproc node Neil Armstrong (4): arm64: dts: qcom: sm8650-hdk: use the PMU to power up bluetooth arm64: dts: qcom: sm8550-qrd: use the PMU to power up bluetooth arm64: dts: amlogic: add clock and clock-names to sound cards arm64: dts: amlogic: gxlx-s905l-p271: drop saradc gxlx compatible Nicolas Pitre (4): arm64: dts: mediatek: mt8186: add lvts definitions arm64: dts: mediatek: mt8186: add default thermal zones arm64: dts: mediatek: mt8188: add lvts definitions arm64: dts: mediatek: mt8188: add default thermal zones Nikita Travkin (2): dt-bindings: arm: qcom: Add msm8916/39 based Lenovo devices arm64: dts: qcom: msm8916-samsung-gt58: Enable the touchkeys Niklas Söderlund (8): arm64: dts: renesas: r8a779g0: R-Car Ethernet TSN support arm64: dts: renesas: white-hawk-single: Wire-up Ethernet TSN arm64: dts: renesas: r8a779g0: Add family fallback for VIN IP arm64: dts: renesas: r8a779a0: Add family fallback for VIN IP arm64: dts: renesas: r8a779h0: Add family fallback for VIN IP arm64: dts: renesas: r8a779g0: Add family fallback for CSISP IP arm64: dts: renesas: r8a779a0: Add family fallback for CSISP IP arm64: dts: renesas: r8a779h0: Add family fallback for CSISP IP Ninad Palsule (1): ARM: dts: aspeed: System1: Updates to BMC board Nishanth Menon (2): arm64: dts: ti: k3-am642-evm-nand: Rename pinctrl node and gpio-hog names arm64: dts: ti: k3-j721s2-evm-gesi-exp-board: Rename gpio-hog node name Nícolas F. R. A. Prado (4): arm64: dts: mediatek: cherry: Specify pull resistance for RSEL GPIOs arm64: dts: mediatek: mt8195-cherry: Remove keyboard-backlight node arm64: dts: mediatek: mt8195: Add SCP phandle to MDP3 DMA controller arm64: dts: mediatek: mt8183-kukui: Disable unused efuse at 8000000 Oleksij Rempel (2): ARM: dts: stm32: stm32mp151a-prtt1l: Fix QSPI configuration dt-bindings: arm: stm32: Add compatible strings for Protonic boards Oliver Rhodes (3): dt-bindings: soc: renesas: Document RZ/G2M v3.0 (r8a774a3) SoC dt-bindings: power: renesas: Document RZ/G2M v3.0 (r8a774a3) SYSC binding dt-bindings: reset: renesas: Document RZ/G2M v3.0 (r8a774a3) reset module Paul Barker (6): arm64: dts: renesas: rzg2l: Enable Ethernet TXC output arm64: dts: renesas: rzg2lc: Enable Ethernet TXC output arm64: dts: renesas: rzg2ul: Enable Ethernet TXC output arm64: dts: renesas: rzg2l: Set Ethernet PVDD to 1.8V arm64: dts: renesas: rzg2lc: Set Ethernet PVDD to 1.8V arm64: dts: renesas: rzg2ul: Set Ethernet PVDD to 1.8V Paul Elder (1): arm64: dts: imx8mp: Add DT nodes for the two ISPs Peng Fan (5): arm64: dts: imx95: add p2a reply channel arm64: dts: imx93: drop duplicated properties dt-bindings: arm: fsl: add i.MX93 14x14 EVK board arm64: dts: imx93: support i.MX93-14x14-EVK board arm64: dts: imx93: add cache info Peter Griffin (1): arm64: dts: exynos: gs101: add syscon-poweroff and syscon-reboot nodes Peter Yin (11): ARM: dts: aspeed: harma: Revise hsc chip ARM: dts: aspeed: harma: Add VR devices ARM: dts: aspeed: harma: Add sgpio name ARM: dts: aspeed: harma: Add ina238 ARM: dts: aspeed: harma: Add power monitor xdp710 ARM: dts: aspeed: harma: Remove multi-host property ARM: dts: aspeed: harma: Add fru device ARM: dts: aspeed: harma: Add temperature device ARM: dts: aspeed: harma: Enable mctp controller ARM: dts: aspeed: harma: Fix spi-gpio dtb_check warnings ARM: dts: aspeed: harma: Remove pca9546 Philippe Schenker (1): arm64: dts: colibri-imx8x: Add 50mhz clock for eth Pi-Hsun Shih (1): arm64: dts: mt8183: add dpi node to mt8183 Pin-yen Lin (1): arm64: dts: mediatek: mt8183: Remove clock from mfg_async power domain Potin Lai (4): dt-bindings: arm: aspeed: add Meta Catalina board ARM: dts: aspeed: catalina: add Meta Catalina BMC ARM: dts: aspeed: catalina: Add pdb cpld io expander ARM: dts: aspeed: catalina: Update io expander line names Prasanth Babu Mantena (1): arm64: dts: ti: k3-am68-sk-som: Update Partition info for OSPI Flash Qingqing Zhou (1): arm64: dts: qcom: sa8775p: Mark APPS and PCIe SMMUs as DMA coherent Rafał Miłecki (4): ARM: dts: broadcom: convert NVMEM content to layout syntax ARM: dts: omap: am335x-bone: convert NVMEM content to layout syntax arm64: dts: mediatek: mt7981: add SPI controllers ARM: dts: aspeed: convert ASRock SPC621D8HM3 NVMEM content to layout syntax Rajendra Nayak (1): arm64: dts: qcom: x1e80100: add rpmh-stats node Raymond Hackley (2): arm64: dts: qcom: msm8916-samsung-rossa: Add touchscreen arm64: dts: qcom: msm8916-samsung-fortuna: Add touch keys Rayyan Ansari (12): arm64: dts: qcom: pmi8994: Add label to wled node arm64: dts: qcom: pmi8950: Remove address from lpg node ARM: dts: qcom: pma8084: add pon node ARM: dts: qcom: apq8064-pins: correct error in drive-strength property ARM: dts: qcom: asus,nexus7-flo: remove duplicate pinctrl handle in i2c nodes ARM: dts: qcom: apq8064: adhere to pinctrl dtschema ARM: dts: qcom: ipq8064: adhere to pinctrl dtschema ARM: dts: qcom: ipq4019: adhere to pinctrl dtschema ARM: dts: qcom: apq8064: drop reg-names on sata-phy node arm64: dts: qcom: msm8939-samsung-a7: rename pwm node to conform to dtschema ARM: dts: qcom: {a,i}pq8064: correct clock-names in sata node ARM: dts: qcom: msm8226-microsoft-common: Add inertial sensors Rob Clark (1): arm64: dts: qcom: x1e80100-yoga: Update panel bindings Rob Herring (2): arm64: dts: toshiba: Fix pl011 and pl022 clocks ARM: dts: Fix undocumented LM75 compatible nodes Rob Herring (Arm) (1): arm: dts: realview: Add/drop missing/spurious unit-addreses Robert Nelson (2): dt-bindings: arm: ti: Add BeagleY-AI arm64: dts: ti: Add k3-am67a-beagley-ai Rohit Agarwal (2): arm64: dts: mediatek: mt8186: Add power domain for DPI arm64: dts: mediatek: mt8186: Add svs node Sachin Gupta (1): arm64: dts: qcom: qcm6490-idp: Add SD Card node Sagar Cheluvegowda (1): arm64: dts: qcom: sa8775p: Add interconnects for ethernet Sam Protsenko (1): dt-bindings: clock: exynos850: Add TMU clock Santhosh Kumar K (1): arm64: dts: ti: k3-am62p: Remove 'reserved' status for ESM Satya Priya Kakitapalli (2): dt-bindings: clock: qcom: Add SM8150 camera clock controller arm64: dts: qcom: Add camera clock controller for sm8150 Sean Nyekjaer (1): ARM: dts: stm32: Add missing gpio options for sdmmc2_d47_pins_d Sergey Bostandzhyan (2): dt-bindings: arm: rockchip: Add NanoPi R2S Plus arm64: dts: rockchip: Add DTS for FriendlyARM NanoPi R2S Plus Shengjiu Wang (4): arm64: dts: imx93: Add #sound-dai-cells property arm64: dts: imx93-11x11-evk: add bt-sco sound card support arm64: dts: imx93-11x11-evk: Add PDM microphone sound card support arm64: dts: imx93-11x11-evk: Add audio XCVR sound card Siddharth Vadapalli (1): arm64: dts: ti: k3-j784s4-evm: Use 4 lanes for PCIe0 on EVM Srinivas Kandagatla (4): arm64: dts: qcom: x1e80100: add soundwire controller resets arm64: dts: x1e80100-crd: fix wsa soundwire port mapping arm64: dts: x1e80100-qcp: fix wsa soundwire port mapping arm64: dts: qcom: sm8250: move lpass codec macros to use clks directly Stanislav Jakubek (3): arm64: dts: sprd: rename SDHCI and fuel gauge nodes to match bindings arm64: dts: sprd: reorder clock-names after clocks arm64: dts: sprd: move/add SPDX license to top of the file Stefan Wahren (3): ARM: dts: bcm2837/bcm2712: adjust local intc node names dt-bindings: timer: convert bcm2835-system-timer bindings to YAML dt-bindings: interrupt-controller: convert bcm2836-l1-intc to yaml Steffen Hemer (1): ARM: dts: ti: omap: am335x-regor: Fix RS485 settings Stephan Gerhold (1): arm64: dts: qcom: x1e80100-crd: Add LID switch Sunyeal Hong (2): dt-bindings: clock: add ExynosAuto v920 SoC CMU bindings arm64: dts: exynosautov920: add initial CMU clock nodes in ExynosAuto v920 Svyatoslav Ryhel (11): ARM: tegra: tf701t: Use unimomentary pinmux setup ARM: tegra: tf701t: Bind VDE device ARM: tegra: tf701t: Correct and complete PMIC and PMC bindings ARM: tegra: tf701t: Add HDMI bindings ARM: tegra: tf701t: Add Bluetooth node ARM: tegra: tf701t: Adjust sensors nodes ARM: tegra: tf701t: Complete sound bindings ARM: tegra: tf701t: Bind WIFI SDIO and EMMC ARM: tegra: tf701t: Re-group GPIO keys ARM: tegra: tf701t: Use dedicated backlight regulator ARM: tegra: tf701t: Configure USB Tarang Raval (3): arm64: dts: imx8mm-emtop-baseboard: Add Ethernet Support dt-bindings: arm: fsl: Add Variscite Symphony board and VAR-SOM-MX8MP SoM arm64: dts: imx8mp-var-som-symphony: Add Variscite Symphony board and VAR-SOM-MX8MP SoM Tengfei Fan (3): arm64: dts: qcom: sa8775p: Add CPU and LLCC BWMON dt-bindings: mailbox: qcom-ipcc: Add GPDSP0 and GPDSP1 clients arm64: dts: qcom: sa8775p: add ADSP, CDSP and GPDSP nodes Teresa Remmet (1): arm64: dts: imx8mp-phyboard-pollux: Add SD-Card vqmmc supply Thomas Bonnefille (2): dt-bindings: interrupt-controller: Add SOPHGO SG2002 plic dt-bindings: riscv: Add Sipeed LicheeRV Nano board compatibles Théo Lebrun (1): arm64: dts: ti: k3-am64: add USB fallback compatible to J721E Tim Harvey (2): dt-bindings: arm: fsl: rename gw7905 to gw75xx arm64: dts: freescale: rename gw7905 to gw75xx Tomasz Maciej Nowak (4): arm64: tegra: Wire up power sensors on Jetson TX1 DevKit arm64: tegra: Wire up Bluetooth on Jetson TX1 module arm64: tegra: Wire up WiFi on Jetson TX1 module ARM: tegra: Wire up two front panel LEDs on TrimSlice Uwe Kleine-König (1): arm64: dts: rockchip: Simplify network PHY connection on qnap-ts433 Varadarajan Narayanan (2): dt-bindings: interconnect: Add Qualcomm IPQ5332 support arm64: dts: qcom: ipq5332: Add icc provider ability to gcc Vedant Deshpande (4): arm64: tegra: Add DMA properties for Tegra234 UARTA arm64: tegra: enable same UARTs for Orin NX/Nano arm64: tegra: Add Tegra234 PCIe C4 EP definition arm64: tegra: Add p3767 PCIe C4 EP details Vibhore Vardhan (1): arm64: dts: ti: k3-am62p5-sk: Remove CTS/RTS from wkup_uart0 pinctrl Vladimir Zapolskiy (2): arm64: dts: qcom: sm8550: add description of CCI controllers arm64: dts: qcom: sm8650: add description of CCI controllers Wadim Egorov (1): arm64: dts: ti: am642-phyboard-electra: Add PRU-ICSSG nodes Wei Fang (1): arm64: dts: imx95: Add NETCMIX block control support Xianwei Zhao (10): arm64: dts: amlogic: a5: add power domain controller node arm64: dts: amlogic: enable some device nodes for S4 arm64: dts: amlogic: s4: add ao secure node arm64: dts: amlogic: c3: add ao secure node arm64: dts: amlogic: t7: add ao secure node arm64: dts: amlogic: a4: add ao secure node dt-bindings: clock: fix C3 PLL input parameter arm64: dts: amlogic: add some device nodes for C3 arm64: dts: amlogic: add C3 AW419 board arm64: dts: amlogic: c3: fix dtbcheck warning Xu Yang (1): arm64: dts: imx95: add DDR Perf Monitor node Yang Chen (18): ARM: dts: aspeed: minerva: change the address of tmp75 ARM: dts: aspeed: minerva: change aliases for uart ARM: dts: aspeed: minerva: add eeprom on i2c bus ARM: dts: aspeed: minerva: change RTC reference ARM: dts: aspeed: minerva: enable mdio3 ARM: dts: aspeed: minerva: remove unused bus and device ARM: dts: aspeed: minerva: Define the LEDs node name ARM: dts: aspeed: minerva: Add adc sensors for fan board ARM: dts: aspeed: minerva: add linename of two pins Yannic Moog (3): arm64: dts: imx8mp-phyboard-pollux: add rtc aux-voltage-chargeable arm64: dts: imx8mm-phyboard-polis: add rtc aux-voltage-chargeable arm64: dts: imx8mm-phygate-tauri-l: add rtc aux-voltage-chargeable Yashwanth Varakala (5): arm64: dts: imx8mp-phycore: Add VDD_IO regulator arm64: dts: imx8mp-phycore: Assign regulator to EEPROM node arm64: dts: imx8mp-phyboard-pollux: Assign regulator to EEPROM node arm64: dts: imx8mp-phyboard-pollux: Add VCC_5V_SW regulator arm64: dts: imx8mp-phyboard-pollux: Add usb3_phy1 regulator reference Yoshihiro Shimoda (2): arm64: dts: renesas: r8a779g0: Add PCIe Host and Endpoint nodes arm64: dts: renesas: white-hawk-cpu-common: Enable PCIe Host ch0 From patchwork Mon Sep 16 16:32:23 2024 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 8bit X-Patchwork-Submitter: Arnd Bergmann X-Patchwork-Id: 13805633 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from smtp.kernel.org (aws-us-west-2-korg-mail-1.web.codeaurora.org [10.30.226.201]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by smtp.lore.kernel.org (Postfix) with ESMTPS id EADD0C3ABB2 for ; Mon, 16 Sep 2024 16:32:48 +0000 (UTC) Received: by smtp.kernel.org (Postfix) id B19AFC4CEC5; Mon, 16 Sep 2024 16:32:48 +0000 (UTC) Received: from fhigh5-smtp.messagingengine.com (fhigh5-smtp.messagingengine.com [103.168.172.156]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by smtp.kernel.org (Postfix) with ESMTPS id 4B06EC4CEC4 for ; Mon, 16 Sep 2024 16:32:46 +0000 (UTC) DMARC-Filter: OpenDMARC Filter v1.4.1 smtp.kernel.org 4B06EC4CEC4 Authentication-Results: smtp.kernel.org; dmarc=pass (p=none dis=none) header.from=arndb.de Authentication-Results: smtp.kernel.org; spf=pass smtp.mailfrom=arndb.de Received: from phl-compute-10.internal (phl-compute-10.phl.internal [10.202.2.50]) by mailfhigh.phl.internal (Postfix) with ESMTP id 58FDD1140193; Mon, 16 Sep 2024 12:32:45 -0400 (EDT) Received: from phl-imap-11 ([10.202.2.101]) by phl-compute-10.internal (MEProxy); Mon, 16 Sep 2024 12:32:45 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=arndb.de; h=cc :cc:content-transfer-encoding:content-type:content-type:date :date:from:from:in-reply-to:in-reply-to:message-id:mime-version :references:reply-to:subject:subject:to:to; s=fm1; t=1726504365; x=1726590765; bh=8RP0FW//mvPeDdQFY2BUjXlSRAxK7/F7viwRwGbc9Nw=; b= nxuFFmEkFmTmggCptLO7hL1DgobS4Ya4ta5dE5Y2MUdFI41EJUTrhpkwATcLKGGP gBDvqxJp8DUwsCtFnGbZw0OLHPsDfEUslDbpsk1LyW+Xtw6+EwAt0/6nSJxWoqSy R5PPlXHZsAkKPUz31L2363GqW+mbNsuYaljt1KSqof+JS/yLACkZsr+BJh7kJ8l3 GJdAbUNCsaUQ2FA1wRT/EexrtcWmNsqNBC9X3ES2+SGbB72XC8VKg3FlG8fMze2/ R+eYqO6GNFGPfaHTBA//yHeyRLesrBKnP7sAGr5CooeUz6bVBVLYuveeyLRM/ijG E4XG2UJaONDom0imm1xhaQ== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:cc:content-transfer-encoding :content-type:content-type:date:date:feedback-id:feedback-id :from:from:in-reply-to:in-reply-to:message-id:mime-version :references:reply-to:subject:subject:to:to:x-me-proxy:x-me-proxy :x-me-sender:x-me-sender:x-sasl-enc; s=fm1; t=1726504365; x= 1726590765; bh=8RP0FW//mvPeDdQFY2BUjXlSRAxK7/F7viwRwGbc9Nw=; b=l xNXyCX6JKbqeBDswchsXM20FnyQOFala2ea7imgPC1g3mG9HUEwE8EVSc/Jkd8EW yL/8ByN2CdwwKgKO42Xppdfp8P1GkpITKreBK6MWhN7sB1RmunQaUKKhm75GjXkh NwrfclI7j0DEiyv4tgxd4I3vrGAWCWTw/CviD52ts71rZN1cSEJESs5fY2nxQa0Q L0fKqdwQgNqpyMfpnkdVI+v7hwV/BIrgy397MDaG106qV6FsSTi4TPTIBWXRijri sM8/L1JwvyeWKnydvrTnfRpHn6h8aHNfS/2yypjIL5gBIWQbP358dm9JuHTzxBkU JieOWKuRCOWobg1/dhKLQ== X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeeftddrudekhedguddttdcutefuodetggdotefrod ftvfcurfhrohhfihhlvgemucfhrghsthforghilhdpggftfghnshhusghstghrihgsvgdp uffrtefokffrpgfnqfghnecuuegrihhlohhuthemuceftddtnecusecvtfgvtghiphhivg hnthhsucdlqddutddtmdenucfjughrpefoggffhffvvefkjghfufgtgfesthhqredtredt jeenucfhrhhomhepfdetrhhnugcuuegvrhhgmhgrnhhnfdcuoegrrhhnugesrghrnhgusg druggvqeenucggtffrrghtthgvrhhnpeejfefhleeigfevudekleekkeeujeeutdeigefg veektdejieffudegtdejueelueenucffohhmrghinhepkhgvrhhnvghlrdhorhhgpdhgih hthhhusgdrtghomhdpphgvnhhguhhtrhhonhhigidruggvnecuvehluhhsthgvrhfuihii vgeptdenucfrrghrrghmpehmrghilhhfrhhomheprghrnhgusegrrhhnuggsrdguvgdpnh gspghrtghpthhtohepgedpmhhouggvpehsmhhtphhouhhtpdhrtghpthhtohepshhotges khgvrhhnvghlrdhorhhgpdhrtghpthhtohepthhorhhvrghlughssehlihhnuhigqdhfoh hunhgurghtihhonhdrohhrghdprhgtphhtthhopehlihhnuhigqdgrrhhmqdhkvghrnhgv lheslhhishhtshdrihhnfhhrrgguvggrugdrohhrghdprhgtphhtthhopehlihhnuhigqd hkvghrnhgvlhesvhhgvghrrdhkvghrnhgvlhdrohhrgh X-ME-Proxy: Feedback-ID: i56a14606:Fastmail Received: by mailuser.phl.internal (Postfix, from userid 501) id F32B2222006F; Mon, 16 Sep 2024 12:32:44 -0400 (EDT) X-Mailer: MessagingEngine.com Webmail Interface MIME-Version: 1.0 Date: Mon, 16 Sep 2024 16:32:23 +0000 From: "Arnd Bergmann" To: "Linus Torvalds" List-Id: Cc: soc@kernel.org, linux-arm-kernel@lists.infradead.org, linux-kernel@vger.kernel.org Message-Id: <8253b661-af65-48ea-8630-24e4b722ad58@app.fastmail.com> In-Reply-To: References: Subject: [GIT PULL 2/4] soc: driver updates for 6.12 The following changes since commit 47ac09b91befbb6a235ab620c32af719f8208399: Linux 6.11-rc4 (2024-08-18 13:17:27 -0700) are available in the Git repository at: https://git.kernel.org/pub/scm/linux/kernel/git/soc/soc.git tags/soc-drivers-6.12 for you to fetch changes up to b62800736f61521547d50fd8cc332cf9b74cbaff: Merge tag 'memory-controller-drv-6.12-2' of https://git.kernel.org/pub/scm/linux/kernel/git/krzk/linux-mem-ctrl into soc/drivers (2024-09-11 09:46:31 +0000) ---------------------------------------------------------------- soc: driver updates for 6.12 The driver updates seem larger this time around, with changes is many of the SoC specific drivers, both the custom drivers/soc ones and the closely related subsystems (memory, bus, firmware, reset, ...). The at91 platform gains support for sam9x7 chips in the soc and power management code. This is the latest variant of one of the oldest still supported SoC families, using the ARM9 (ARMv5) core. As usual, the qualcomm snapdragon platform gets a ton of updates in many of their drivers to add more features and additional SoC support. Most of these are somewhat firmware related as the platform has a number of firmware based interfaces to the kernel. A notable addition here is the inclusion of trace events to two of these drivers. Herve Codina and Christophe Leroy are now sending updates for drivers/soc/fsl/ code through the SoC tree, this contains both PowerPC and Arm specific platforms and has previously been problematic to maintain. The first update here contains support for newer PowerPC variants and some cleanups. The turris mox firmware driver has a number of updates, mostly cleanups. The Arm SCMI firmware driver gets a major rework to modularize the existing code into separately loadable drivers for the various transports, the addition of custom NXP i.MX9 interfaces and a number of smaller updates. The Arm FF-A firmware driver gets a feature update to support the v1.2 version of the specification. The reset controller drivers have some smaller cleanups and a newly added driver for the Intel/Mobileye EyeQ5/EyeQ6 MIPS SoCs. The memory controller drivers get some cleanups and refactoring for Tegra, TI, Freescale/NXP and a couple more platforms. Finally there are lots of minor updates to firmware (raspberry pi, tegra, imx), bus (sunxi, omap, tegra) and soc (rockchips, tegra, amlogic, mediatek) drivers and their DT bindings. ---------------------------------------------------------------- Aakarsh Jain (1): dt-bindings: media: s5p-mfc: Remove s5p-mfc.txt binding Alex Bee (1): soc: rockchip: grf: Set RK3128's vpu main clock AngeloGioacchino Del Regno (1): soc: mediatek: mtk-mutex: Reduce type size for mtk_mutex_data members Arnd Bergmann (23): Merge tag 'samsung-drivers-6.12' of https://git.kernel.org/pub/scm/linux/kernel/git/krzk/linux into soc/drivers Merge tag 'memory-controller-drv-6.12' of https://git.kernel.org/pub/scm/linux/kernel/git/krzk/linux-mem-ctrl into soc/drivers Merge tag 'v6.12-rockchip-drivers-1' of https://git.kernel.org/pub/scm/linux/kernel/git/mmind/linux-rockchip into soc/drivers Merge tag 'versatile-soc-for-v6.12' of https://git.kernel.org/pub/scm/linux/kernel/git/linusw/linux-integrator into soc/drivers Merge tag 'ffa-updates-6.12' of https://git.kernel.org/pub/scm/linux/kernel/git/sudeep.holla/linux into soc/drivers Merge tag 'scmi-updates-6.12' of https://git.kernel.org/pub/scm/linux/kernel/git/sudeep.holla/linux into soc/drivers Merge tag 'tegra-for-6.12-soc' of https://git.kernel.org/pub/scm/linux/kernel/git/tegra/linux into soc/drivers Merge tag 'tegra-for-6.12-firmware' of https://git.kernel.org/pub/scm/linux/kernel/git/tegra/linux into soc/drivers Merge tag 'soc_fsl-6.12-2' of https://github.com/chleroy/linux into soc/drivers Merge tag 'ti-driver-soc-for-v6.12' of https://git.kernel.org/pub/scm/linux/kernel/git/ti/linux into soc/drivers Merge tag 'integrator-v6.12' of https://git.kernel.org/pub/scm/linux/kernel/git/linusw/linux-integrator into soc/drivers Merge tag 'reset-for-v6.12' of git://git.pengutronix.de/pza/linux into soc/drivers Merge tag 'imx-drivers-6.12' of https://git.kernel.org/pub/scm/linux/kernel/git/shawnguo/linux into soc/drivers Merge tag 'omap-for-v6.12/drivers-signed' of https://git.kernel.org/pub/scm/linux/kernel/git/khilman/linux-omap into soc/drivers Merge tag 'at91-soc-6.12' of https://git.kernel.org/pub/scm/linux/kernel/git/at91/linux into soc/drivers Merge tag 'qcom-drivers-for-6.12' of https://git.kernel.org/pub/scm/linux/kernel/git/qcom/linux into soc/drivers Merge tag 'amlogic-drivers-for-v6.12' of https://git.kernel.org/pub/scm/linux/kernel/git/amlogic/linux into soc/drivers Merge tag 'sunxi-drivers-for-6.12' of https://git.kernel.org/pub/scm/linux/kernel/git/sunxi/linux into soc/drivers firmware: imx: remove duplicate scmi_imx_misc_ctrl_get() Merge tag 'v6.11-next-soc' of https://git.kernel.org/pub/scm/linux/kernel/git/mediatek/linux into soc/drivers Merge tag 'v6.12-rockchip-drivers-2' of https://git.kernel.org/pub/scm/linux/kernel/git/mmind/linux-rockchip into soc/drivers Merge tag 'arm-soc/for-6.12/drivers' of https://github.com/Broadcom/stblinux into soc/drivers Merge tag 'memory-controller-drv-6.12-2' of https://git.kernel.org/pub/scm/linux/kernel/git/krzk/linux-mem-ctrl into soc/drivers Bartosz Golaszewski (4): memory: ti-aemif: remove platform data support memory: ti-aemif: use devm_clk_get_enabled() and shrink the code memory: ti-aemif: don't needlessly iterate over child nodes memory: ti-aemif: Revert "memory: ti-aemif: don't needlessly iterate over child nodes" Biju Das (1): memory: renesas-rpc-if: Use Hi-Z state as the default setting for IOVF pins Bjorn Andersson (1): Merge branch 'drivers-fixes-for-6.11' into HEAD Christophe JAILLET (4): soc: mediatek: pwrap: Constify struct pmic_wrapper_type soc: mediatek: pwrap: Constify some struct int[] soc: mediatek: pwrap: Use devm_clk_bulk_get_all_enable() soc: ti: k3-ringacc: Constify struct k3_ring_ops Christophe Leroy (2): Merge branch 'support-for-quicc-engine-tsa-and-qmc' soc: fsl: cpm1: qmc: Fix dependency on fsl_soc.h Clément Léger (1): reset: core: add get_device()/put_device on rcdev Cristian Marussi (11): firmware: arm_scmi: Fix double free in OPTEE transport firmware: arm_scmi: Introduce packet handling helpers firmware: arm_scmi: Add support for standalone transport drivers firmware: arm_scmi: Make MBOX transport a standalone driver firmware: arm_scmi: Make SMC transport a standalone driver firmware: arm_scmi: Make OPTEE transport a standalone driver firmware: arm_scmi: Make VirtIO transport a standalone driver firmware: arm_scmi: Remove legacy transport-layer code firmware: arm_scmi: Update various protocols versions firmware: arm_scmi: Remove const from transport descriptors firmware: arm_scmi: Use max-rx-timeout-ms from devicetree Dan Carpenter (1): platform: cznic: turris-omnia-mcu: Fix error check in omnia_mcu_register_trng() Danila Tikhonov (4): dt-bindings: arm: qcom,ids: Add IDs for SM7325 family soc: qcom: socinfo: Add Soc IDs for SM7325 family soc: qcom: pd_mapper: Add SM7325 compatible dt-bindings: soc: qcom: qcom,pmic-glink: Document SM7325 compatible David Wu (1): soc: rockchip: io-domain: Add RK3308 IO voltage domains Detlev Casanova (3): dt-bindings: soc: rockchip: Add rk3576 syscon compatibles soc: rockchip: grf: Add rk3576 default GRF values dt-bindings: arm: rockchip: Add rk3576 compatible string to pmu.yaml Dhruva Gole (1): bus: ti-sysc: Remove excess struct member 'disable_on_idle' description Diogo Ivo (7): memory: tegra: Remove periodic compensation duplicate calls memory: tegra: Move DQSOSC measurement to common place memory: tegra: Reword and correct comments memory: tegra: Change macros to interpret parameter as integer memory: tegra: Loop update_clock_tree_delay() memory: tegra: Move compare/update current delay values to a function memory: tegra: Rework update_clock_tree_delay() Dmitry Baryshkov (3): Revert "soc: qcom: smd-rpm: Match rpmsg channel instead of compatible" dt-bindings: soc: qcom: smd-rpm: add generic compatibles soc: qcom: smd-rpm: add qcom,smd-rpm compatible Etienne Carriere (1): firmware: arm_scmi: Fix voltage description in failure cases Gaosheng Cui (1): ARM: OMAP2+: Remove obsoleted declaration for gpmc_onenand_init Herve Codina (37): soc: fsl: cpm1: qmc: Update TRNSYNC only in transparent mode soc: fsl: cpm1: qmc: Enable TRNSYNC only when needed soc: fsl: cpm1: tsa: Fix tsa_write8() soc: fsl: cpm1: tsa: Use BIT(), GENMASK() and FIELD_PREP() macros soc: fsl: cpm1: tsa: Fix blank line and spaces soc: fsl: cpm1: tsa: Add missing spinlock comment dt-bindings: soc: fsl: cpm_qe: Add QUICC Engine (QE) TSA controller soc: fsl: cpm1: tsa: Remove unused registers offset definition soc: fsl: cpm1: tsa: Use ARRAY_SIZE() instead of hardcoded integer values soc: fsl: cpm1: tsa: Make SIRAM entries specific to CPM1 soc: fsl: cpm1: tsa: Introduce tsa_setup() and its CPM1 compatible version soc: fsl: cpm1: tsa: Isolate specific CPM1 part from tsa_serial_{dis}connect() soc: fsl: cpm1: tsa: Introduce tsa_version soc: fsl: cpm1: tsa: Add support for QUICC Engine (QE) implementation MAINTAINERS: Add QE files related to the Freescale TSA controller soc: fsl: cpm1: tsa: Introduce tsa_serial_get_num() soc: fsl: cpm1: qmc: Rename QMC_TSA_MASK soc: fsl: cpm1: qmc: Use BIT(), GENMASK() and FIELD_PREP() macros soc: fsl: cpm1: qmc: Fix blank line and spaces soc: fsl: cpm1: qmc: Remove unneeded parenthesis soc: fsl: cpm1: qmc: Fix 'transmiter' typo soc: fsl: cpm1: qmc: Add missing spinlock comment dt-bindings: soc: fsl: cpm_qe: Add QUICC Engine (QE) QMC controller soc: fsl: cpm1: qmc: Introduce qmc_data structure soc: fsl: cpm1: qmc: Re-order probe() operations soc: fsl: cpm1: qmc: Introduce qmc_init_resource() and its CPM1 version soc: fsl: cpm1: qmc: Introduce qmc_{init,exit}_xcc() and their CPM1 version soc: fsl: cpm1: qmc: Rename qmc_chan_command() soc: fsl: cpm1: qmc: Handle RPACK initialization soc: fsl: cpm1: qmc: Rename SCC_GSMRL_MODE_QMC soc: fsl: cpm1: qmc: Introduce qmc_version soc: fsl: qe: Add resource-managed muram allocators soc: fsl: qe: Add missing PUSHSCHED command soc: fsl: cpm1: qmc: Add support for QUICC Engine (QE) implementation soc: fsl: cpm1: qmc: Handle QUICC Engine (QE) soft-qmc firmware MAINTAINERS: Add QE files related to the Freescale QMC controller soc: fsl: qe: ucc: Export ucc_mux_set_grant_tsa_bkpt Jingyi Wang (2): dt-bindings: arm: qcom,ids: add SoC ID for QCS8275/QCS8300 soc: qcom: socinfo: add QCS8275/QCS8300 SoC ID Jinjie Ruan (1): soc/tegra: pmc: Simplify with scoped for each OF child loop Jonas Karlman (1): dt-bindings: power: rockchip: Document RK3308 IO voltage domains Konrad Dybcio (2): firmware: qcom: scm: Allow QSEECOM on ThinkPad T14s firmware: qcom: scm: Allow QSEECOM on Surface Laptop 7 models Kousik Sanagavarapu (4): soc: ti: pruss: factor out memories setup soc: ti: pruss: do device_node auto cleanup soc: ti: knav_qmss_queue: do device_node auto cleanup soc: ti: pm33xx: do device_node auto cleanup Krzysztof Kozlowski (45): memory: tegra186-emc: drop unused to_tegra186_emc() soc: qcom: apr: simplify with scoped for each OF child loop soc: qcom: aoss: simplify with scoped for each OF child loop soc: qcom: ice: use scoped device node handling to simplify error paths soc: qcom: ocmem: use scoped device node handling to simplify error paths soc: qcom: pbs: use scoped device node handling to simplify error paths soc: qcom: smp2p: use scoped device node handling to simplify error paths firmware: arm_scmi: Simplify with scoped for each OF child loop dt-bindings: samsung: exynos-usi: add missing constraints dt-bindings: memory-controllers: renesas,rpc-if: add top-level constraints memory: atmel-ebi: use scoped device node handling to simplify error paths memory: atmel-ebi: simplify with scoped for each OF child loop memory: samsung: exynos5422-dmc: simplify dmc->dev usage memory: samsung: exynos5422-dmc: use scoped device node handling to simplify error paths memory: stm32-fmc2-ebi: simplify with scoped for each OF child loop memory: stm32-fmc2-ebi: simplify with dev_err_probe() memory: tegra-mc: simplify with scoped for each OF child loop memory: tegra124-emc: simplify with scoped for each OF child loop memory: tegra20-emc: simplify with scoped for each OF child loop memory: tegra30-emc: simplify with scoped for each OF child loop memory: ti-aemif: simplify with dev_err_probe() memory: ti-aemif: simplify with scoped for each OF child loop memory: emif: drop unused 'irq_state' member memory: emif: simplify locking with guard() memory: omap-gpmc: simplify locking with guard() memory: pl172: simplify with dev_err_probe() memory: pl172: simplify with devm_clk_get_enabled() memory: pl353-smc: simplify with dev_err_probe() memory: pl353-smc: simplify with devm_clk_get_enabled() firmware: tegra: bpmp: Drop unused mbox_client_to_bpmp() firmware: tegra: bpmp: Use scoped device node handling to simplify error paths soc: versatile: integrator: fix OF node leak in probe() error path soc: versatile: realview: fix memory leak during device remove soc: versatile: realview: fix soc_dev leak during device remove soc: versatile: enable compile testing memory: pl172: simplify releasing AMBA regions with devm memory: pl353-smc: simplify with scoped for each OF child loop ARM: versatile: fix OF node leak in CPUs prepare bus: integrator-lm: fix OF node leak in probe() dt-bindings: reset: socionext,uniphier-glue-reset: add top-level constraints reset: berlin: fix OF node leak in probe() error path reset: k210: fix OF node leak in probe() error path reset: simplify locking with guard() reset: lpc18xx: simplify with dev_err_probe() reset: lpc18xx: simplify with devm_clk_get_enabled() Lu Baolu (1): soc: fsl: qbman: Use iommu_paging_domain_alloc() Luke Parkin (5): firmware: arm_scmi: Remove superfluous handle_to_scmi_info firmware: arm_scmi: Add support for debug metrics at the interface firmware: arm_scmi: Track basic SCMI communication debug metrics firmware: arm_scmi: Create debugfs files for SCMI communication debug metrics firmware: arm_scmi: Add support to reset the debug metrics Marek Behún (16): firmware: turris-mox-rwtm: Use macro constant instead of hardcoded 4096 firmware: turris-mox-rwtm: Use ETH_ALEN instead of hardcoded 6 firmware: turris-mox-rwtm: Use the boolean type where appropriate firmware: turris-mox-rwtm: Hide signature related constants behind macros firmware: turris-mox-rwtm: Fix driver includes firmware: turris-mox-rwtm: Use sysfs_emit() instead of sprintf() firmware: turris-mox-rwtm: Don't create own kobject type firmware: turris-mox-rwtm: Simplify debugfs code firmware: turris-mox-rwtm: Convert rest to devm_* and get rid of driver .remove() firmware: turris-mox-rwtm: Use dev_err_probe() where possible firmware: turris-mox-rwtm: Drop redundant device pointer firmware: turris-mox-rwtm: Use devm_mutex_init() instead of mutex_init() firmware: turris-mox-rwtm: Use container_of() instead of hwrng .priv member firmware: turris-mox-rwtm: Use EOPNOTSUPP instead of ENOSYS firmware: turris-mox-rwtm: Use ALIGN() instead of hardcoding firmware: turris-mox-rwtm: Deduplicate command execution code Mukesh Ojha (3): firmware: qcom: scm: Disable SDI and write no dump to dump mode firmware: qcom: scm: Refactor code to support multiple dload mode firmware: qcom: scm: Add multiple download mode support Peng Fan (10): dt-bindings: firmware: arm,scmi: Add support for system power protocol firmware: arm_scmi: Introduce setup_shmem_iomap dt-bindings: firmware: arm,scmi: Introduce property max-rx-timeout-ms dt-bindings: firmware: Add i.MX95 SCMI Extension protocol firmware: arm_scmi: Add NXP i.MX95 SCMI documentation firmware: arm_scmi: Add initial support for i.MX BBM protocol firmware: arm_scmi: Add initial support for i.MX MISC protocol firmware: imx: Add i.MX95 MISC driver input: keyboard: support i.MX95 BBM module rtc: support i.MX95 BBM RTC Rajendra Nayak (1): soc: qcom: llcc: Update configuration data for x1e80100 Rob Herring (Arm) (5): memory: emif: Use of_property_read_bool() bus: ti-sysc: Use of_property_present() soc: ti: knav: Drop unnecessary check for property presence soc: ti: knav: Use of_property_read_variable_u32_array() dt-bindings: memory-controllers: fsl,imx-weim: Fix "fsl,weim-cs-timing" schema Rong Qianfeng (1): memory: mtk-smi: Use devm_clk_get_enabled() Shivnandan Kumar (1): soc: qcom: icc-bwmon: Add tracepoints in bwmon_intr_thread Stefan Wahren (1): firmware: raspberrypi: Improve timeout warning Stephan Gerhold (2): soc: qcom: pd_mapper: Add X1E80100 soc: qcom: pd_mapper: Add more older platforms without domains Sudeep Holla (10): firmware: arm_ffa: Some coding style fixes firmware: arm_ffa: Update the FF-A command list with v1.2 additions firmware: arm_ffa: Move the function ffa_features() earlier firmware: arm_ffa: Add support for FFA_PARTITION_INFO_GET_REGS firmware: arm_ffa: Add support for FFA_MSG_SEND_DIRECT_{REQ,RESP}2 firmware: arm_ffa: Add support for FFA_YIELD in direct messaging firmware: arm_ffa: Fetch the Rx/Tx buffer size using ffa_features() firmware: arm_scmi: Fix trivial whitespace/coding style issues firmware: arm_scmi: Replace the use of of_node_put() to __free(device_node) firmware: arm_scmi: Replace comma with the semicolon Sudeepgoud Patil (1): soc: qcom: smp2p: Introduce tracepoint support Théo Lebrun (2): Revert "dt-bindings: reset: mobileye,eyeq5-reset: add bindings" reset: eyeq: add platform driver Varshini Rajendran (5): dt-bindings: atmel-sysreg: add sam9x7 ARM: at91: pm: add support for sam9x7 SoC family ARM: at91: pm: add sam9x7 SoC init config ARM: at91: add support in SoC driver for new sam9x7 ARM: at91: Kconfig: add config flag for SAM9X7 SoC Wu Bo (2): bus: imx-weim: support compile test bus: imx-weim: change to use devm_clk_get_enabled() helper Xianwei Zhao (2): dt-bindings: arm: amlogic: meson-gx-ao-secure: support more SoCs soc: amlogic: meson-gx-socinfo: add new SoCs id Xiaolei Wang (1): soc: fsl: qbman: Remove redundant warnings Zelong Dong (2): dt-bindings: reset: Add Amlogic T7 reset controller reset: reset-meson: Add support for Amlogic T7 SoC reset controller Zhang Zekun (1): bus: sunxi-rsb: Simplify code with dev_err_probe() .mailmap | 2 + .../arm/amlogic/amlogic,meson-gx-ao-secure.yaml | 16 +- .../devicetree/bindings/arm/atmel-sysregs.txt | 6 +- .../devicetree/bindings/arm/rockchip/pmu.yaml | 2 + .../devicetree/bindings/clock/qcom,rpmcc.yaml | 2 +- .../devicetree/bindings/firmware/arm,scmi.yaml | 20 +- .../bindings/firmware/nxp,imx95-scmi.yaml | 43 + .../devicetree/bindings/media/s5p-mfc.txt | 0 .../memory-controllers/fsl/fsl,imx-weim.yaml | 25 +- .../memory-controllers/renesas,rpc-if.yaml | 4 +- .../bindings/power/rockchip-io-domain.yaml | 24 + .../bindings/remoteproc/qcom,glink-rpm-edge.yaml | 2 +- .../bindings/remoteproc/qcom,rpm-proc.yaml | 4 +- .../bindings/reset/amlogic,meson-reset.yaml | 1 + .../bindings/reset/mobileye,eyeq5-reset.yaml | 43 - .../reset/socionext,uniphier-glue-reset.yaml | 8 +- .../bindings/soc/fsl/cpm_qe/fsl,qe-tsa.yaml | 210 +++++ .../bindings/soc/fsl/cpm_qe/fsl,qe-ucc-qmc.yaml | 197 +++++ .../bindings/soc/qcom/qcom,pmic-glink.yaml | 5 + .../devicetree/bindings/soc/qcom/qcom,smd-rpm.yaml | 74 +- .../devicetree/bindings/soc/qcom/qcom,smd.yaml | 2 +- .../devicetree/bindings/soc/rockchip/grf.yaml | 16 + .../bindings/soc/samsung/exynos-usi.yaml | 15 +- MAINTAINERS | 10 +- arch/arm/mach-at91/Kconfig | 22 +- arch/arm/mach-at91/Makefile | 1 + arch/arm/mach-at91/generic.h | 2 + arch/arm/mach-at91/pm.c | 29 + arch/arm/mach-at91/sam9x7.c | 33 + arch/arm/mach-versatile/platsmp-realview.c | 1 + drivers/bus/Kconfig | 2 +- drivers/bus/arm-integrator-lm.c | 1 + drivers/bus/imx-weim.c | 14 +- drivers/bus/sunxi-rsb.c | 34 +- drivers/bus/ti-sysc.c | 7 +- drivers/firmware/arm_ffa/driver.c | 240 ++++-- drivers/firmware/arm_scmi/Kconfig | 120 +-- drivers/firmware/arm_scmi/Makefile | 14 +- drivers/firmware/arm_scmi/base.c | 6 +- drivers/firmware/arm_scmi/clock.c | 1 + drivers/firmware/arm_scmi/common.h | 208 +++-- drivers/firmware/arm_scmi/driver.c | 241 +++--- drivers/firmware/arm_scmi/msg.c | 32 +- drivers/firmware/arm_scmi/perf.c | 2 +- drivers/firmware/arm_scmi/pinctrl.c | 1 + drivers/firmware/arm_scmi/power.c | 2 +- drivers/firmware/arm_scmi/reset.c | 2 +- drivers/firmware/arm_scmi/sensors.c | 2 +- drivers/firmware/arm_scmi/shmem.c | 85 +- drivers/firmware/arm_scmi/system.c | 2 +- drivers/firmware/arm_scmi/transports/Kconfig | 123 +++ drivers/firmware/arm_scmi/transports/Makefile | 16 + .../firmware/arm_scmi/{ => transports}/mailbox.c | 84 +- drivers/firmware/arm_scmi/{ => transports}/optee.c | 131 ++- drivers/firmware/arm_scmi/{ => transports}/smc.c | 62 +- .../firmware/arm_scmi/{ => transports}/virtio.c | 103 +-- drivers/firmware/arm_scmi/vendors/imx/Kconfig | 25 + drivers/firmware/arm_scmi/vendors/imx/Makefile | 3 + drivers/firmware/arm_scmi/vendors/imx/imx-sm-bbm.c | 383 +++++++++ .../firmware/arm_scmi/vendors/imx/imx-sm-misc.c | 318 ++++++++ drivers/firmware/arm_scmi/vendors/imx/imx95.rst | 886 +++++++++++++++++++++ drivers/firmware/arm_scmi/voltage.c | 6 +- drivers/firmware/imx/Kconfig | 11 + drivers/firmware/imx/Makefile | 1 + drivers/firmware/imx/sm-misc.c | 119 +++ drivers/firmware/qcom/Kconfig | 11 - drivers/firmware/qcom/qcom_scm-smc.c | 2 +- drivers/firmware/qcom/qcom_scm.c | 72 +- drivers/firmware/qcom/qcom_tzmem.c | 32 +- drivers/firmware/raspberrypi.c | 3 +- drivers/firmware/tegra/bpmp.c | 20 +- drivers/firmware/turris-mox-rwtm.c | 380 ++++----- drivers/input/keyboard/Kconfig | 11 + drivers/input/keyboard/Makefile | 1 + drivers/input/keyboard/imx-sm-bbm-key.c | 225 ++++++ drivers/memory/atmel-ebi.c | 35 +- drivers/memory/emif.c | 31 +- drivers/memory/mtk-smi.c | 6 +- drivers/memory/omap-gpmc.c | 24 +- drivers/memory/pl172.c | 58 +- drivers/memory/pl353-smc.c | 57 +- drivers/memory/renesas-rpc-if.c | 2 +- drivers/memory/samsung/exynos5422-dmc.c | 90 +-- drivers/memory/stm32-fmc2-ebi.c | 23 +- drivers/memory/tegra/mc.c | 11 +- drivers/memory/tegra/tegra124-emc.c | 7 +- drivers/memory/tegra/tegra186-emc.c | 5 - drivers/memory/tegra/tegra20-emc.c | 7 +- drivers/memory/tegra/tegra210-emc-cc-r21021.c | 429 ++-------- drivers/memory/tegra/tegra30-emc.c | 7 +- drivers/memory/ti-aemif.c | 74 +- drivers/platform/cznic/turris-omnia-mcu-trng.c | 4 +- drivers/reset/Kconfig | 13 + drivers/reset/Makefile | 1 + drivers/reset/core.c | 17 +- drivers/reset/reset-berlin.c | 3 +- drivers/reset/reset-eyeq.c | 570 +++++++++++++ drivers/reset/reset-k210.c | 3 +- drivers/reset/reset-lpc18xx.c | 43 +- drivers/reset/reset-meson.c | 6 + drivers/rtc/Kconfig | 11 + drivers/rtc/Makefile | 1 + drivers/rtc/rtc-imx-sm-bbm.c | 162 ++++ drivers/soc/Makefile | 2 +- drivers/soc/amlogic/meson-gx-socinfo.c | 10 + drivers/soc/atmel/soc.c | 23 + drivers/soc/atmel/soc.h | 9 + drivers/soc/fsl/qbman/qman_ccsr.c | 2 - drivers/soc/fsl/qbman/qman_portal.c | 5 +- drivers/soc/fsl/qe/Kconfig | 17 +- drivers/soc/fsl/qe/qe_common.c | 80 ++ drivers/soc/fsl/qe/qmc.c | 667 ++++++++++++---- drivers/soc/fsl/qe/tsa.c | 659 +++++++++++---- drivers/soc/fsl/qe/tsa.h | 3 + drivers/soc/fsl/qe/ucc.c | 1 + drivers/soc/mediatek/mtk-mutex.c | 52 +- drivers/soc/mediatek/mtk-pmic-wrap.c | 118 +-- drivers/soc/qcom/Kconfig | 2 +- drivers/soc/qcom/Makefile | 1 + drivers/soc/qcom/apr.c | 5 +- drivers/soc/qcom/cmd-db.c | 2 +- drivers/soc/qcom/icc-bwmon.c | 6 +- drivers/soc/qcom/ice.c | 14 +- drivers/soc/qcom/llcc-qcom.c | 32 +- drivers/soc/qcom/ocmem.c | 7 +- drivers/soc/qcom/qcom-pbs.c | 16 +- drivers/soc/qcom/qcom_aoss.c | 8 +- drivers/soc/qcom/qcom_pd_mapper.c | 17 +- drivers/soc/qcom/smd-rpm.c | 41 +- drivers/soc/qcom/smp2p.c | 25 +- drivers/soc/qcom/socinfo.c | 4 + drivers/soc/qcom/trace-smp2p.h | 98 +++ drivers/soc/qcom/trace_icc-bwmon.h | 48 ++ drivers/soc/rockchip/grf.c | 32 +- drivers/soc/rockchip/io-domain.c | 40 + drivers/soc/tegra/pmc.c | 12 +- drivers/soc/ti/k3-ringacc.c | 12 +- drivers/soc/ti/knav_dma.c | 22 +- drivers/soc/ti/knav_qmss_queue.c | 105 +-- drivers/soc/ti/pm33xx.c | 52 +- drivers/soc/ti/pruss.c | 176 ++-- drivers/soc/versatile/Kconfig | 4 +- drivers/soc/versatile/soc-integrator.c | 1 + drivers/soc/versatile/soc-realview.c | 20 +- include/dt-bindings/arm/qcom,ids.h | 4 + include/dt-bindings/soc/qe-fsl,tsa.h | 13 + include/linux/arm_ffa.h | 12 + include/linux/firmware/imx/sm.h | 23 + include/linux/firmware/qcom/qcom_qseecom.h | 45 -- include/linux/omap-gpmc.h | 10 - include/linux/platform_data/ti-aemif.h | 45 -- include/linux/scmi_imx_protocol.h | 59 ++ include/soc/fsl/qe/qe.h | 23 +- 153 files changed, 6727 insertions(+), 2520 deletions(-) create mode 100644 Documentation/devicetree/bindings/firmware/nxp,imx95-scmi.yaml delete mode 100644 Documentation/devicetree/bindings/media/s5p-mfc.txt delete mode 100644 Documentation/devicetree/bindings/reset/mobileye,eyeq5-reset.yaml create mode 100644 Documentation/devicetree/bindings/soc/fsl/cpm_qe/fsl,qe-tsa.yaml create mode 100644 Documentation/devicetree/bindings/soc/fsl/cpm_qe/fsl,qe-ucc-qmc.yaml create mode 100644 arch/arm/mach-at91/sam9x7.c create mode 100644 drivers/firmware/arm_scmi/transports/Kconfig create mode 100644 drivers/firmware/arm_scmi/transports/Makefile rename drivers/firmware/arm_scmi/{ => transports}/mailbox.c (85%) rename drivers/firmware/arm_scmi/{ => transports}/optee.c (89%) rename drivers/firmware/arm_scmi/{ => transports}/smc.c (86%) rename drivers/firmware/arm_scmi/{ => transports}/virtio.c (94%) create mode 100644 drivers/firmware/arm_scmi/vendors/imx/Kconfig create mode 100644 drivers/firmware/arm_scmi/vendors/imx/Makefile create mode 100644 drivers/firmware/arm_scmi/vendors/imx/imx-sm-bbm.c create mode 100644 drivers/firmware/arm_scmi/vendors/imx/imx-sm-misc.c create mode 100644 drivers/firmware/arm_scmi/vendors/imx/imx95.rst create mode 100644 drivers/firmware/imx/sm-misc.c create mode 100644 drivers/input/keyboard/imx-sm-bbm-key.c create mode 100644 drivers/reset/reset-eyeq.c create mode 100644 drivers/rtc/rtc-imx-sm-bbm.c create mode 100644 drivers/soc/qcom/trace-smp2p.h create mode 100644 drivers/soc/qcom/trace_icc-bwmon.h create mode 100644 include/dt-bindings/soc/qe-fsl,tsa.h create mode 100644 include/linux/firmware/imx/sm.h delete mode 100644 include/linux/platform_data/ti-aemif.h create mode 100644 include/linux/scmi_imx_protocol.h From patchwork Mon Sep 16 16:32:53 2024 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 8bit X-Patchwork-Submitter: Arnd Bergmann X-Patchwork-Id: 13805634 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from smtp.kernel.org (aws-us-west-2-korg-mail-1.web.codeaurora.org [10.30.226.201]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by smtp.lore.kernel.org (Postfix) with ESMTPS id 401C4C3ABB2 for ; Mon, 16 Sep 2024 16:33:18 +0000 (UTC) Received: by smtp.kernel.org (Postfix) id 25467C4CEC5; Mon, 16 Sep 2024 16:33:18 +0000 (UTC) Received: from fhigh5-smtp.messagingengine.com (fhigh5-smtp.messagingengine.com [103.168.172.156]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by smtp.kernel.org (Postfix) with ESMTPS id 26ACAC4CEC4 for ; Mon, 16 Sep 2024 16:33:16 +0000 (UTC) DMARC-Filter: OpenDMARC Filter v1.4.1 smtp.kernel.org 26ACAC4CEC4 Authentication-Results: smtp.kernel.org; dmarc=pass (p=none dis=none) header.from=arndb.de Authentication-Results: smtp.kernel.org; spf=pass smtp.mailfrom=arndb.de Received: from phl-compute-10.internal (phl-compute-10.phl.internal [10.202.2.50]) by mailfhigh.phl.internal (Postfix) with ESMTP id 2D47711402C0; Mon, 16 Sep 2024 12:33:16 -0400 (EDT) Received: from phl-imap-11 ([10.202.2.101]) by phl-compute-10.internal (MEProxy); Mon, 16 Sep 2024 12:33:16 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=arndb.de; h=cc :cc:content-transfer-encoding:content-type:content-type:date :date:from:from:in-reply-to:in-reply-to:message-id:mime-version :references:reply-to:subject:subject:to:to; s=fm1; t=1726504396; x=1726590796; bh=vZIcbrAnjSA4s0p+zFS0c7vxQRLPVZtsGWABr76p9TM=; b= Omy2mdbx6J6goCyiYQrovp/HecGw/tZLTLQzm2LFZ4oGGY4qnoBmS29abgnuITc2 IEUUiamm1/p4qPrMynfqSd/44x17lzYdQ/wL6GklDIb6LELrT4mjBDuGKj7BEBMX bz6wFMTUUFHYDEQ8BYErcw+TBEkhgn7J9dkwMeNikNXeVL4pq1IJwoOdLiinTXMI w2QZqPyE63iPuwUVtd1z4Xn3SD3F3K+XTnkvdAFnO1Jj/7+li+KgtuTPP+u5dSzu 4Aq3W2sFJTFyeb43uiZp8H1PSMUzFu8sM3F1NGpHyA6BQ8HwAhAK5w3xCRx8aWY2 xnpA5ZGm84/p0yDf6A0/NQ== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:cc:content-transfer-encoding :content-type:content-type:date:date:feedback-id:feedback-id :from:from:in-reply-to:in-reply-to:message-id:mime-version :references:reply-to:subject:subject:to:to:x-me-proxy:x-me-proxy :x-me-sender:x-me-sender:x-sasl-enc; s=fm1; t=1726504396; x= 1726590796; bh=vZIcbrAnjSA4s0p+zFS0c7vxQRLPVZtsGWABr76p9TM=; b=R wT2LOkEIDa1rzyvQvZfkmxfwDwb7JLLygkgTMszEwpIBSwpxQ/a7OpoQVgUjfpRK izoioPQDcTrd3tamZN4UDc/ikDkoXnj39Wzi/wWwWRuMpOMHjVA4lGHBb4sZUQAx WnOfiG0PKyzqg+p7ZrzOF9FZMKOek7qqgNS+0S6kxyzIF+3qq+5xpwPaZJ7cZkOK FH0zAo63hMCAemnKITP7Kd1HQcj/8AVcgJpPTaWs1jNWgCyVclFTsFbSs9x652Qf YYF9bdHIaBGuUdKl3MIk4JgzYtgpnJgynWPHv+nvF7TjYQIbXbdpu5ThabOGnchN 7ZxhUBPwpmo6FODZhnSvQ== X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeeftddrudekhedguddttdcutefuodetggdotefrod ftvfcurfhrohhfihhlvgemucfhrghsthforghilhdpggftfghnshhusghstghrihgsvgdp uffrtefokffrpgfnqfghnecuuegrihhlohhuthemuceftddtnecusecvtfgvtghiphhivg hnthhsucdlqddutddtmdenucfjughrpefoggffhffvvefkjghfufgtgfesthhqredtredt jeenucfhrhhomhepfdetrhhnugcuuegvrhhgmhgrnhhnfdcuoegrrhhnugesrghrnhgusg druggvqeenucggtffrrghtthgvrhhnpeekvdeuhfeitdeuieejvedtieeijeefleevffef leekieetjeffvdekgfetuefhgfenucffohhmrghinhepkhgvrhhnvghlrdhorhhgnecuve hluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehmrghilhhfrhhomheprghrnhgusegr rhhnuggsrdguvgdpnhgspghrtghpthhtohepgedpmhhouggvpehsmhhtphhouhhtpdhrtg hpthhtohepshhotgeskhgvrhhnvghlrdhorhhgpdhrtghpthhtohepthhorhhvrghlughs sehlihhnuhigqdhfohhunhgurghtihhonhdrohhrghdprhgtphhtthhopehlihhnuhigqd grrhhmqdhkvghrnhgvlheslhhishhtshdrihhnfhhrrgguvggrugdrohhrghdprhgtphht thhopehlihhnuhigqdhkvghrnhgvlhesvhhgvghrrdhkvghrnhgvlhdrohhrgh X-ME-Proxy: Feedback-ID: i56a14606:Fastmail Received: by mailuser.phl.internal (Postfix, from userid 501) id D37D5222006F; Mon, 16 Sep 2024 12:33:15 -0400 (EDT) X-Mailer: MessagingEngine.com Webmail Interface MIME-Version: 1.0 Date: Mon, 16 Sep 2024 16:32:53 +0000 From: "Arnd Bergmann" To: "Linus Torvalds" List-Id: Cc: soc@kernel.org, linux-arm-kernel@lists.infradead.org, linux-kernel@vger.kernel.org Message-Id: <3618c698-8305-460f-bddb-67e4e06f524a@app.fastmail.com> In-Reply-To: References: Subject: [GIT PULL 3/4] soc: defconfig updates for 6.12 The following changes since commit 47ac09b91befbb6a235ab620c32af719f8208399: Linux 6.11-rc4 (2024-08-18 13:17:27 -0700) are available in the Git repository at: https://git.kernel.org/pub/scm/linux/kernel/git/soc/soc.git tags/soc-defconfig-6.12 for you to fetch changes up to 7eee0f8bbd1b6946236624d25a938cb34c1ba2a9: Merge tag 'v6.11-next-defconfig' of https://git.kernel.org/pub/scm/linux/kernel/git/mediatek/linux into soc/defconfig (2024-09-11 09:05:18 +0000) ---------------------------------------------------------------- soc: defconfig updates for 6.12 The updates to the defconfig files are fairly small, enabling drivers for eight of the arm and riscv based platforms. ---------------------------------------------------------------- Alexandre Mergnat (1): arm64: defconfig: enable mt8365 sound Arnd Bergmann (8): Merge tag 'at91-defconfig-6.12' of https://git.kernel.org/pub/scm/linux/kernel/git/at91/linux into soc/defconfig Merge tag 'renesas-arm-defconfig-for-v6.12-tag1' of https://git.kernel.org/pub/scm/linux/kernel/git/geert/renesas-devel into soc/defconfig Merge tag 'tegra-for-6.12-arm64-defconfig' of https://git.kernel.org/pub/scm/linux/kernel/git/tegra/linux into soc/defconfig Merge tag 'ti-k3-config-for-v6.12' of https://git.kernel.org/pub/scm/linux/kernel/git/ti/linux into soc/defconfig Merge tag 'imx-defconfig-6.12' of https://git.kernel.org/pub/scm/linux/kernel/git/shawnguo/linux into soc/defconfig Merge tag 'qcom-arm64-defconfig-for-6.12' of https://git.kernel.org/pub/scm/linux/kernel/git/qcom/linux into soc/defconfig Merge tag 'riscv-config-for-v6.12' of https://git.kernel.org/pub/scm/linux/kernel/git/conor/linux into soc/defconfig Merge tag 'v6.11-next-defconfig' of https://git.kernel.org/pub/scm/linux/kernel/git/mediatek/linux into soc/defconfig Chen Wang (1): riscv: defconfig: sophgo: enable clks for sg2042 Devarsh Thakkar (1): arm64: defconfig: Enable E5010 JPEG Encoder Dmitry Baryshkov (1): arm64: defconfig: build CONFIG_REGULATOR_QCOM_REFGEN as module Geert Uytterhoeven (1): ARM: shmobile: defconfig: Enable slab hardening and kmalloc buckets Inochi Amaoto (1): riscv: defconfig: Enable pinctrl support for CV18XX Series SoC Jon Hunter (1): arm64: defconfig: Enable Tegra194 PCIe Endpoint Kuninori Morimoto (1): arm64: defconfig: Enable AK4619 codec support Liu Ying (1): arm64: defconfig: Enable ADP5585 GPIO and PWM drivers Niklas Söderlund (1): arm64: defconfig: Enable R-Car Ethernet-TSN support Varshini Rajendran (1): ARM: configs: at91: enable config flags for sam9x7 SoC family arch/arm/configs/at91_dt_defconfig | 1 + arch/arm/configs/shmobile_defconfig | 1 + arch/arm64/configs/defconfig | 10 ++++++++++ arch/riscv/configs/defconfig | 7 +++++++ 4 files changed, 19 insertions(+) From patchwork Mon Sep 16 16:33:54 2024 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 8bit X-Patchwork-Submitter: Arnd Bergmann X-Patchwork-Id: 13805635 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from smtp.kernel.org (aws-us-west-2-korg-mail-1.web.codeaurora.org [10.30.226.201]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by smtp.lore.kernel.org (Postfix) with ESMTPS id 97481C3ABA2 for ; Mon, 16 Sep 2024 16:34:17 +0000 (UTC) Received: by smtp.kernel.org (Postfix) id 8C0A9C4CEC5; Mon, 16 Sep 2024 16:34:17 +0000 (UTC) Received: from fout8-smtp.messagingengine.com (fout8-smtp.messagingengine.com [103.168.172.151]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits)) (No client certificate requested) by smtp.kernel.org (Postfix) with ESMTPS id 6E01CC4CEC4 for ; Mon, 16 Sep 2024 16:34:16 +0000 (UTC) DMARC-Filter: OpenDMARC Filter v1.4.1 smtp.kernel.org 6E01CC4CEC4 Authentication-Results: smtp.kernel.org; dmarc=pass (p=none dis=none) header.from=arndb.de Authentication-Results: smtp.kernel.org; spf=pass smtp.mailfrom=arndb.de Received: from phl-compute-10.internal (phl-compute-10.phl.internal [10.202.2.50]) by mailfout.phl.internal (Postfix) with ESMTP id 7D46D138034D; Mon, 16 Sep 2024 12:34:15 -0400 (EDT) Received: from phl-imap-11 ([10.202.2.101]) by phl-compute-10.internal (MEProxy); Mon, 16 Sep 2024 12:34:15 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=arndb.de; h=cc :cc:content-transfer-encoding:content-type:content-type:date :date:from:from:in-reply-to:in-reply-to:message-id:mime-version :references:reply-to:subject:subject:to:to; s=fm1; t=1726504455; x=1726590855; bh=MF6OSe4OwxwiUUdXA8NPrvTTf2EYnLfaKG5OwH1xAXc=; b= dkbxMGvJMJ3CO4NhUdTwPhJ7yt9CGT4CqtGwCFOYASyN60ujHSaWNIu8lqlLYu+v W+gMxGZYQYR8Eih2PBi1vDq8lfqp4F+tJiQpsxQd8k7876C3NC6/vVPfcseQlq4x YTFegMqhGKbIAtgDlhWcq7++QEFKyAxrJfcrCPoeW6QUfDSpNBh/QyCmCBXd9ooX k6xhCN7DpYGYhAuylUVcCL1wNb5g/RXK348Fr4SrqpOesGbQMVGS2yYxtOqCZZFr Au3vw44TlWRoWMkadb3l+NaRhI12jav968vnanVlYsveBcTqpvmGGiEaZV0nJPCP O0RLX349HesUMks3ROdk1w== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:cc:content-transfer-encoding :content-type:content-type:date:date:feedback-id:feedback-id :from:from:in-reply-to:in-reply-to:message-id:mime-version :references:reply-to:subject:subject:to:to:x-me-proxy:x-me-proxy :x-me-sender:x-me-sender:x-sasl-enc; s=fm1; t=1726504455; x= 1726590855; bh=MF6OSe4OwxwiUUdXA8NPrvTTf2EYnLfaKG5OwH1xAXc=; b=I OvOIvuQ/uVTxf51kB0pkXdSKSHPRAZcYx6xisURTJj6f9AumC5EXi8WXCoPdUXTA 6DoFpPKxxD/AXWMH55cnBlYuE9Q0Kf1NUQJkKWP/Tk6pkeSWiMhPjoF4TTquEZ1X x1zBdmOFjhkXjBDWiFtyd7TAQR90a2T7RQ3FqM4K5+ThEhwapQxorbbNi7o1FMkC tOMPvndQEaJLVF3foLO4lBb8cb3+LNuJ1kqOdqfV4zELVOM5nIS0gJZu7WMgZk9f gli21lfU38ZSL8yW6BPcjR+b1Nap+z6iOiATSXfBTydGEcWHq66R6dNQWtR5D16P yFyhcfFgvFM9NSLB+05dQ== X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeeftddrudekhedguddttdcutefuodetggdotefrod ftvfcurfhrohhfihhlvgemucfhrghsthforghilhdpggftfghnshhusghstghrihgsvgdp uffrtefokffrpgfnqfghnecuuegrihhlohhuthemuceftddtnecusecvtfgvtghiphhivg hnthhsucdlqddutddtmdenucfjughrpefoggffhffvvefkjghfufgtgfesthhqredtredt jeenucfhrhhomhepfdetrhhnugcuuegvrhhgmhgrnhhnfdcuoegrrhhnugesrghrnhgusg druggvqeenucggtffrrghtthgvrhhnpeefueegkeffveeugeehieehiedukeegfefhffeu tdettdffteeluefhheetkeekvdenucffohhmrghinhepkhgvrhhnvghlrdhorhhgpdhgih hthhhusgdrtghomhenucevlhhushhtvghrufhiiigvpedunecurfgrrhgrmhepmhgrihhl fhhrohhmpegrrhhnugesrghrnhgusgdruggvpdhnsggprhgtphhtthhopeegpdhmohguvg epshhmthhpohhuthdprhgtphhtthhopehsohgtsehkvghrnhgvlhdrohhrghdprhgtphht thhopehtohhrvhgrlhgusheslhhinhhugidqfhhouhhnuggrthhiohhnrdhorhhgpdhrtg hpthhtoheplhhinhhugidqrghrmhdqkhgvrhhnvghlsehlihhsthhsrdhinhhfrhgruggv rggurdhorhhgpdhrtghpthhtoheplhhinhhugidqkhgvrhhnvghlsehvghgvrhdrkhgvrh hnvghlrdhorhhg X-ME-Proxy: Feedback-ID: i56a14606:Fastmail Received: by mailuser.phl.internal (Postfix, from userid 501) id 4101D222006F; Mon, 16 Sep 2024 12:34:15 -0400 (EDT) X-Mailer: MessagingEngine.com Webmail Interface MIME-Version: 1.0 Date: Mon, 16 Sep 2024 16:33:54 +0000 From: "Arnd Bergmann" To: "Linus Torvalds" List-Id: Cc: soc@kernel.org, linux-arm-kernel@lists.infradead.org, linux-kernel@vger.kernel.org Message-Id: <4c6e42ce-7919-4031-b2ac-ffa3a10cbaaa@app.fastmail.com> In-Reply-To: References: Subject: [GIT PULL 4/4] soc: arm platform updates for 6.12 The following changes since commit 47ac09b91befbb6a235ab620c32af719f8208399: Linux 6.11-rc4 (2024-08-18 13:17:27 -0700) are available in the Git repository at: https://git.kernel.org/pub/scm/linux/kernel/git/soc/soc.git tags/soc-arm-6.12 for you to fetch changes up to 46d2efc4efc00e09a47e41f753af69a9fe169ec4: Merge tag 'arm-soc/for-6.12/soc' of https://github.com/Broadcom/stblinux into soc/arm (2024-09-10 16:39:45 +0000) ---------------------------------------------------------------- soc: arm platform updates for 6.12 Most of these updates are for removing dead code on the Samsung S3C, NXP i.MX, TI OMAP and TI DaVinci platforms, though this appears to be a coincidence. There are also cleanups for the Marvell Orion family and the Arm integrator series and a Kconfig change for Broadcom. ---------------------------------------------------------------- Andrew Davis (1): ARM: orion5x: Switch to new sys-off handler API Andy Shevchenko (1): ARM: omap2: Switch to use kmemdup_array() Arnd Bergmann (7): Merge tag 'integrator-v6.12' of https://git.kernel.org/pub/scm/linux/kernel/git/linusw/linux-integrator into soc/arm Merge tag 'omap-for-v6.12/soc-signed' of https://git.kernel.org/pub/scm/linux/kernel/git/khilman/linux-omap into soc/arm Merge tag 'davinci-updates-for-v6.12-rc1' of https://git.kernel.org/pub/scm/linux/kernel/git/brgl/linux into soc/arm Merge tag 'imx-soc-6.12' of https://git.kernel.org/pub/scm/linux/kernel/git/shawnguo/linux into soc/arm Merge tag 'samsung-soc-6.12' of https://git.kernel.org/pub/scm/linux/kernel/git/krzk/linux into soc/arm Merge tag 'mvebu-arm-6.12-1' of https://git.kernel.org/pub/scm/linux/kernel/git/gclement/mvebu into soc/arm Merge tag 'arm-soc/for-6.12/soc' of https://github.com/Broadcom/stblinux into soc/arm Bartosz Golaszewski (1): ARM: davinci: remove unused cpuidle code Dr. David Alan Gilbert (1): ARM: omap1: Remove unused struct 'dma_link_info' Fabio Estevam (1): ARM: mach-imx: imx6sx: Remove Ethernet refclock setting Florian Fainelli (1): ARM: bcm: Select ARM_GIC_V3 for ARCH_BRCMSTB Gaosheng Cui (6): ARM: davinci: remove unused davinci_cfg_reg_list() declaration ARM: davinci: remove unused davinci_init_ide() declaration ARM: s3c: Remove unused s3c_init_uart_irqs() declaration ARM: s3c: remove unused declarations for s3c6400 ARM: s3c: remove unused s3c2410_cpu_suspend() declaration ARM: OMAP1: Remove unused declarations in arch/arm/mach-omap1/pm.h Krzysztof Kozlowski (2): ARM: versatile: fix OF node leak in CPUs prepare bus: integrator-lm: fix OF node leak in probe() Nathan Chancellor (1): ARM: imx: Annotate imx7d_enet_init() as __init Sam Protsenko (1): MAINTAINERS: Add entry for Samsung Exynos850 SoC Uwe Kleine-König (3): ARM: s3c: Drop explicit initialization of struct i2c_device_id::driver_data to 0 ARM: mvebu: Warn about memory chunks too small for DDR training ARM: dove: Drop a write-only variable MAINTAINERS | 10 +++ arch/arm/mach-bcm/Kconfig | 1 + arch/arm/mach-davinci/Makefile | 1 - arch/arm/mach-davinci/common.h | 1 - arch/arm/mach-davinci/cpuidle.c | 99 -------------------------- arch/arm/mach-davinci/cpuidle.h | 15 ---- arch/arm/mach-davinci/devices-da8xx.c | 1 - arch/arm/mach-davinci/mux.h | 5 -- arch/arm/mach-dove/common.c | 4 +- arch/arm/mach-imx/mach-imx6sx.c | 22 ------ arch/arm/mach-imx/mach-imx7d.c | 2 +- arch/arm/mach-mvebu/board-v7.c | 3 + arch/arm/mach-omap1/omap-dma.c | 13 ---- arch/arm/mach-omap1/pm.h | 4 -- arch/arm/mach-omap2/omap_device.c | 2 +- arch/arm/mach-orion5x/board-mss2.c | 2 +- arch/arm/mach-orion5x/dns323-setup.c | 6 +- arch/arm/mach-orion5x/kurobox_pro-setup.c | 2 +- arch/arm/mach-orion5x/mv2120-setup.c | 2 +- arch/arm/mach-orion5x/net2big-setup.c | 2 +- arch/arm/mach-orion5x/terastation_pro2-setup.c | 2 +- arch/arm/mach-orion5x/ts209-setup.c | 2 +- arch/arm/mach-orion5x/ts409-setup.c | 2 +- arch/arm/mach-s3c/irq-uart-s3c64xx.h | 2 - arch/arm/mach-s3c/mach-crag6410-module.c | 2 +- arch/arm/mach-s3c/pm.h | 2 - arch/arm/mach-s3c/s3c64xx.h | 11 --- arch/arm/mach-versatile/platsmp-realview.c | 1 + drivers/bus/arm-integrator-lm.c | 1 + 29 files changed, 31 insertions(+), 191 deletions(-) delete mode 100644 arch/arm/mach-davinci/cpuidle.c delete mode 100644 arch/arm/mach-davinci/cpuidle.h