From patchwork Wed Oct 2 15:15:36 2024 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: Patrick Steinhardt X-Patchwork-Id: 13819929 Received: from fhigh-a1-smtp.messagingengine.com (fhigh-a1-smtp.messagingengine.com [103.168.172.152]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by smtp.subspace.kernel.org (Postfix) with ESMTPS id D7F4D1CF7D3 for ; Wed, 2 Oct 2024 15:15:41 +0000 (UTC) Authentication-Results: smtp.subspace.kernel.org; arc=none smtp.client-ip=103.168.172.152 ARC-Seal: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1727882144; cv=none; b=G0Rx175moE4PLb9bi3GBcQRvRnmqTOjuXDhw+w9Hp9NTA0oW0wf0J3gkNWPIWcgar0N+NNM5/su7v7/i8ImS4BcdPSsoJoiHVmPmP98PpNqTzv2kOfmlOUz/WSf0lOTrzHB9kITfyAR9lToPaJqwjFGrxoac1sXignw6KWVD+Ek= ARC-Message-Signature: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1727882144; c=relaxed/simple; bh=jEj6BS0rq4jxlbfMdxZBesDNUiMh1sDh9OzImyzRiOs=; h=Date:From:To:Cc:Subject:Message-ID:References:MIME-Version: Content-Type:Content-Disposition:In-Reply-To; b=c59Im9PhmZXsnQ51E42fe6uqjr96pbqA6orc+t0mZc+Lfd69VI1o7R+RjZ/MN6HZBriMFVncv7v1Xa9EuwNH1iib2+UcvgSQFz5KM1Qg0F4hzyfqIyru5va4VBCXyX4CdK6N27YeUgk5K4ugzSaXfXpy6ufZ/1B9Hk4NtICMK0M= ARC-Authentication-Results: i=1; smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=pks.im; spf=pass smtp.mailfrom=pks.im; dkim=pass (2048-bit key) header.d=pks.im header.i=@pks.im header.b=ZZMXgf6c; dkim=pass (2048-bit key) header.d=messagingengine.com header.i=@messagingengine.com header.b=gzFSoV4E; arc=none smtp.client-ip=103.168.172.152 Authentication-Results: smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=pks.im Authentication-Results: smtp.subspace.kernel.org; spf=pass smtp.mailfrom=pks.im Authentication-Results: smtp.subspace.kernel.org; dkim=pass (2048-bit key) header.d=pks.im header.i=@pks.im header.b="ZZMXgf6c"; dkim=pass (2048-bit key) header.d=messagingengine.com header.i=@messagingengine.com header.b="gzFSoV4E" Received: from phl-compute-10.internal (phl-compute-10.phl.internal [10.202.2.50]) by mailfhigh.phl.internal (Postfix) with ESMTP id E83451140170; Wed, 2 Oct 2024 11:15:40 -0400 (EDT) Received: from phl-mailfrontend-02 ([10.202.2.163]) by phl-compute-10.internal (MEProxy); Wed, 02 Oct 2024 11:15:40 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=pks.im; h=cc:cc :content-type:content-type:date:date:from:from:in-reply-to :in-reply-to:message-id:mime-version:references:reply-to:subject :subject:to:to; s=fm2; t=1727882140; x=1727968540; bh=RsZRRwbYHz wK1iFLUsGExCVro0zySn2+uAq44i8Sa9M=; b=ZZMXgf6c8z063584CMDTW20Fgb vhGUtSnFxtIT/CuZjPgpCizAmEQEYnN0xeGFpxd4AYsOoQpTUzDCx6cKwa9b9wep rYlttf822gnvk4gJTXXS1fjDH/9EeXBALfyISJ9zyM/bkzZLwaDNxEL/K7hUaY+a qfhoWunjtYyOS9NR+uN4nyBdjMN+NxSOqJywbQVPLujB0NkDc6F++BR2KTdW7b9I hE56L4Qiw4wrxlV1xdANCBnTiuuI54RXif/WWavcmnDrxm0/kPlFj4gXDqdSphNS CLeg68SvWTfvEJtXmVzFBRCjS4YdVh4o0qryV0LAeEqgti7GOoAxsta4cD1w== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:cc:content-type:content-type:date:date :feedback-id:feedback-id:from:from:in-reply-to:in-reply-to :message-id:mime-version:references:reply-to:subject:subject:to :to:x-me-proxy:x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s= fm2; t=1727882140; x=1727968540; bh=RsZRRwbYHzwK1iFLUsGExCVro0zy Sn2+uAq44i8Sa9M=; b=gzFSoV4E05Iet7ymbX7hSqVG+tJbPlQRkYeTSeclT/P7 i93F6P8fluJPZbLm1noa4er3uyBMCN63PdOLv2r9Oock5r+wNDI/sThLhDXV0gSk zHbWvs67gVa6tBB1U7kKrfahLjfEAnFoYuKdxRaP8ApsAxBIl1HImdnivTwHqTpm 4t/OkYrny5UmWWfA+IQX6exLzxwWsN2dPt0srVilvu3TL3jsEd0xqyFBqj3ev0U3 P6SOwrfdKorKVVrVlKhMvkLkBgzvxY/TOekUVTGr8kMeGgBmzGqfNnDuZW9YRMn/ WJZL/2/IWMQBmQ7dhOgTRc3yIJfwrROTB/4HafbHfQ== X-ME-Sender: X-ME-Received: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeeftddrvdduledgkeefucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfu rfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucesvcftvggtihhpihgvnh htshculddquddttddmnecujfgurhepfffhvfevuffkfhggtggujgesthdtredttddtvden ucfhrhhomheprfgrthhrihgtkhcuufhtvghinhhhrghrughtuceophhssehpkhhsrdhimh eqnecuggftrfgrthhtvghrnhepveefffdtgfekhfdttdejhefgffffjedtfeelueetgfeh heehudeihffgjedvkeegnecuffhomhgrihhnpehtgihtrdgruhhtohenucevlhhushhtvg hrufhiiigvpedtnecurfgrrhgrmhepmhgrihhlfhhrohhmpehpshesphhkshdrihhmpdhn sggprhgtphhtthhopedvpdhmohguvgepshhmthhpohhuthdprhgtphhtthhopegvshgthh ifrghrthiisehgvghnthhoohdrohhrghdprhgtphhtthhopehgihhtsehvghgvrhdrkhgv rhhnvghlrdhorhhg X-ME-Proxy: Feedback-ID: i197146af:Fastmail Received: by mail.messagingengine.com (Postfix) with ESMTPA; Wed, 2 Oct 2024 11:15:39 -0400 (EDT) Received: by vm-mail (OpenSMTPD) with ESMTPSA id 67df1324 (TLSv1.3:TLS_AES_256_GCM_SHA384:256:NO); Wed, 2 Oct 2024 15:14:48 +0000 (UTC) Date: Wed, 2 Oct 2024 17:15:36 +0200 From: Patrick Steinhardt To: git@vger.kernel.org Cc: Eli Schwartz Subject: [RFC PATCH 01/21] Documentation: add comparison of build systems Message-ID: <508e3783d284fd2d3bd4840907ed0bdc20bc1b23.1727881164.git.ps@pks.im> References: Precedence: bulk X-Mailing-List: git@vger.kernel.org List-Id: List-Subscribe: List-Unsubscribe: MIME-Version: 1.0 Content-Disposition: inline In-Reply-To: We're contemplating whether to eventually replace our build systems with a build system that is easier to use. Add a comparison of build systems to our technical documentation as a baseline for discussion. Signed-off-by: Patrick Steinhardt --- Documentation/Makefile | 1 + Documentation/technical/build-systems.txt | 164 ++++++++++++++++++++++ 2 files changed, 165 insertions(+) create mode 100644 Documentation/technical/build-systems.txt diff --git a/Documentation/Makefile b/Documentation/Makefile index 0f55baa252..e23cffb5f9 100644 --- a/Documentation/Makefile +++ b/Documentation/Makefile @@ -111,6 +111,7 @@ TECH_DOCS += MyFirstObjectWalk TECH_DOCS += SubmittingPatches TECH_DOCS += ToolsForGit TECH_DOCS += technical/bitmap-format +TECH_DOCS += technical/build-systems TECH_DOCS += technical/bundle-uri TECH_DOCS += technical/hash-function-transition TECH_DOCS += technical/long-running-process-protocol diff --git a/Documentation/technical/build-systems.txt b/Documentation/technical/build-systems.txt new file mode 100644 index 0000000000..8fac36ce1d --- /dev/null +++ b/Documentation/technical/build-systems.txt @@ -0,0 +1,164 @@ += Build Systems + +The build system is the primary way for both developers and system integrators +to interact with the Git project. As such, we consider it important to pick a +build system that fulfills our requirements while being easy to use and extend. + +This document outlines the different requirements that we have for the build +system and then compares available build systems using these criteria. + +== Requirements + +The following subsections prevent a list of requirements that we have for any +potential build system. Sections are sorted by decreasing priority, even though +these priorities will naturally differ between users. + +=== Platform support + +The most important criterium is whether the build system supports all of the +platforms that Git supports. The most important platforms include: + + - Linux + - macOS + - Windows + - FreeBSD + - OpenBSD + - NetBSD + +The platforms which must be supported by the tool should be aligned with our +[platform support policy](platform-support.txt). + +=== Auto-detection of supported features + +The build system MUST support auto-detection of features which are or aren't +available on the current platform. Platform maintainers should not be required +to manually configure the complete build. + +Auto-detection of the following items is considered to be important: + + - Check for the existence of headers. + - Check for the existence of libraries. + - Check for the existence of exectuables. + - Check for the runtime behavior of specific functions. + +=== Ease of use + +The build system SHOULD be both easy to use and easy to extend. While this is +naturally a subjective metric it is likely not controversial to say that some +build systems are considerably harder to use than others. + +=== IDE support + +The build system SHOULD integrate with well-known IDEs. Well-known IDEs include: + + - Microsoft Visual Studio + - Visual Studio Code + - Xcode + +There are four levels of support: + + - Native integration into the IDE. + - Integration into the IDE via a plugin. + - Integration into the IDE via generating a project description with the build + system. + - No integration. + +Native integration is preferable, but integration via either a plugin or by +generating a project description via the build system are considered feasible +alternatives. + +Another important distinction is the level of integration. There are two +features that one generally wants to have: + + - Integration of build targets. + - Automatic setup of features like code completion with detected build + dependencies. + +The first bullet point is the bare minimum, but is not sufficient to be +considered proper integration. + +=== Out-of-tree builds + +The build system SHOULD support out-of-tree builds. Out-of-tree builds allow a +developer to configure multiple different build directories with different +configuration, e.g. one "debug" build and one "release" build. + +=== Rust support + +Many long-time Git contributors are nowadays in favor of adopting Rust as a +second language next to C. The build system SHOULD thus support Rust such that +we do not have to reopen the discussion once we decide to pick up Rust. + +== Comparison + +The following list of build systems are considered: + +- GNU Make +- autoconf +- CMake +- Meson + +=== GNU Make + +- Platform support: ubitquitous on all platforms, but not well-integrated into Windows. +- Auto-detection: no built-in support for auto-detection of features. +- Ease of use: easy to use, but discovering available options is hard. Makefile + rules can quickly get out of hand once reaching a certain scope. +- IDE support: execution of Makefile targets is supported by many IDEs +- Out-of-tree builds: supported in theory, not wired up in practice. +- Rust: can be added. + +=== autoconf + +- Platform support: ubiquitous on all platforms, but not well-integrated into Windows. +- Auto-detection: supported. +- Ease of use: easy to use, discovering available options is comparatively + easy. The autoconf syntax is prohibitively hard to extend though due to its + complex set of interacting files and the hard-to-understand M4 language. +- IDE support: no integration into IDEs at generation time. The generated + Makefiles have the same level of support as GNU Make. +- Out-of-tree builds: supported in theory, not wired up in practice. +- Rust: not supported. + +=== CMake + +- Platform support: not as extensive as GNU Make or autoconf, but all major + platforms are supported. + - AIX + - Cygwin + - FreeBSD + - Linux + - OpenBSD + - Solaris + - Windows + - macOS +- Ease of use: easy to use, discovering available options is not always + trivial. The scripting language used by CMake is somewhat cumbersome to use, + but extending CMake build instructions is doable. +- IDE support: natively integrated into Microsoft Visual Studio. Can generate + project descriptions for Xcode. An extension is available for Visual Studio + Code. Many other IDEs have plugins for CMake. +- Out-of-tree builds: supported. +- Rust: not supported. + +=== Meson + +- Platform: not as extensive as GNU Make or autoconf, but all major platforms + and some smaller ones are supported. + - AIX + - Cygwin + - DragonflyBSD + - FreeBSD + - Haiku + - Linux + - NetBSD + - OpenBSD + - Solaris + - Windows + - macOS +- Ease of use: easy to use, discovering available options is easy. The + scripting language is straight-forward to use. +- IDE support: Supports generating build instructions for Xcode and Microsoft + Visual Studio, a plugin exists for Visual Studio Code. +- Out-of-tree builds: supported. +- Rust: supported. From patchwork Wed Oct 2 15:15:39 2024 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: Patrick Steinhardt X-Patchwork-Id: 13819931 Received: from fout-a3-smtp.messagingengine.com (fout-a3-smtp.messagingengine.com [103.168.172.146]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by smtp.subspace.kernel.org (Postfix) with ESMTPS id D7C881D07BF for ; Wed, 2 Oct 2024 15:15:43 +0000 (UTC) Authentication-Results: smtp.subspace.kernel.org; arc=none smtp.client-ip=103.168.172.146 ARC-Seal: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1727882145; cv=none; b=Vv7aN7yPgWeRM6WO8PXrJh4omHggdVOsgNAtjs/uweTHKAi2UEHWK+Z0970VRM6VouLeL9TJmFvKIsbtO1KnQWS2GHiBIp2GuAyuKYt+3k5Xgf5AC+nsrZT43QpFZ/yKAzFOdILcY3XaNzrLliMdr5avpf09u7t9W+8x2iuo8j0= ARC-Message-Signature: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1727882145; c=relaxed/simple; bh=YPygr9srEyiMQCsMZGlzYK7vwuLj++Huy6fJlW8mbFU=; h=Date:From:To:Cc:Subject:Message-ID:References:MIME-Version: Content-Type:Content-Disposition:In-Reply-To; b=DgEa9uMBa6tQuXbdJ3+xpAqUm91R53mTfe0uuelfwNXukHiwH2rFIBbcX6lSqrIP0g4uKYCOl/QExP1fCPepDiSnfZtialWtQ1svtxyUeodngzfyX85SWnEjfkoKjIAKTmTE3TSmiwFIH3+edK1HeIJRrjfRYSCDIy28AzLekBA= ARC-Authentication-Results: i=1; smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=pks.im; spf=pass smtp.mailfrom=pks.im; dkim=pass (2048-bit key) header.d=pks.im header.i=@pks.im header.b=IDWOcqFL; dkim=pass (2048-bit key) header.d=messagingengine.com header.i=@messagingengine.com header.b=ZsHjvInv; arc=none smtp.client-ip=103.168.172.146 Authentication-Results: smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=pks.im Authentication-Results: smtp.subspace.kernel.org; spf=pass smtp.mailfrom=pks.im Authentication-Results: smtp.subspace.kernel.org; dkim=pass (2048-bit key) header.d=pks.im header.i=@pks.im header.b="IDWOcqFL"; dkim=pass (2048-bit key) header.d=messagingengine.com header.i=@messagingengine.com header.b="ZsHjvInv" Received: from phl-compute-10.internal (phl-compute-10.phl.internal [10.202.2.50]) by mailfout.phl.internal (Postfix) with ESMTP id 08FE91380236; Wed, 2 Oct 2024 11:15:43 -0400 (EDT) Received: from phl-mailfrontend-02 ([10.202.2.163]) by phl-compute-10.internal (MEProxy); Wed, 02 Oct 2024 11:15:43 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=pks.im; h=cc:cc :content-type:content-type:date:date:from:from:in-reply-to :in-reply-to:message-id:mime-version:references:reply-to:subject :subject:to:to; s=fm2; t=1727882143; x=1727968543; bh=f6NI1yU/2K 2dqdVufs2d5vlCaMJHHFsslp7GCaG86lk=; b=IDWOcqFL+EOEfQ76om11UUtYQd P13gmOw+Dz9EED54qjp/ZqJBrpSN8G/ji3d6LCsU7EAs4CW3rViGZt6FGmEp8IbD xWLLXJBQXCAK6qy5FBjgu1KNVVZZ9Q4mTB+mq5c8ULNPi/iT13qKZUvakfBXE/+D 1Vwc1D7vr5yPBI4sDsQwZhG287nargcpsMPB1Fx1YKnjU8m3AC+jmTnyA43YmGyI gbX7pIYuq0dSHUAIgTeFoO4Ogup5MwbbS+kpDELPQIgsSMR4hK4DrIzrje1Xzykj /CGzHq5qvC2IfSzePHICwVFuEaYCl1DdaIx9J2vGnn82xQT4TMCeiHLMqjDA== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:cc:content-type:content-type:date:date :feedback-id:feedback-id:from:from:in-reply-to:in-reply-to :message-id:mime-version:references:reply-to:subject:subject:to :to:x-me-proxy:x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s= fm2; t=1727882143; x=1727968543; bh=f6NI1yU/2K2dqdVufs2d5vlCaMJH HFsslp7GCaG86lk=; b=ZsHjvInvi4nAhkRGE7BVCEkkQhd1WMVgi7Yiw3N6uEvw 2x7QoZT2bjjCDoveAJRmk9nAwngDHDzMTu1Ki23L2c6m4SbvoSMva9un0phTQJY7 dREA0aFJtwCBztXgh+F43KA4UAQTpCR76oYFUWs4YVI4rriJFOZBUOnT+a7D47px 9+I2L5rWbCEudbS6Y9jH6/HdzGG4lR8xZ9gg0o3XIJd+/rvNBTAPpNzhnbhHAj2E ie9N4KAI7Wp9I0GNDV1OMSnxMRjuniZoK9acdNDN7GrZYPcW1GbaEmKlN9QLiS/m B+Ghh884vf++9DGd8w5S3B/Tze+8WmK6MFCndHl9TQ== X-ME-Sender: X-ME-Received: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeeftddrvdduledgkeefucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfu rfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucesvcftvggtihhpihgvnh htshculddquddttddmnecujfgurhepfffhvfevuffkfhggtggujgesthdtredttddtvden ucfhrhhomheprfgrthhrihgtkhcuufhtvghinhhhrghrughtuceophhssehpkhhsrdhimh eqnecuggftrfgrthhtvghrnhepveekkeffhfeitdeludeigfejtdetvdelvdduhefgueeg udfghfeukefhjedvkedtnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehmrg hilhhfrhhomhepphhssehpkhhsrdhimhdpnhgspghrtghpthhtohepvddpmhhouggvpehs mhhtphhouhhtpdhrtghpthhtohepghhithesvhhgvghrrdhkvghrnhgvlhdrohhrghdprh gtphhtthhopegvshgthhifrghrthiisehgvghnthhoohdrohhrgh X-ME-Proxy: Feedback-ID: i197146af:Fastmail Received: by mail.messagingengine.com (Postfix) with ESMTPA; Wed, 2 Oct 2024 11:15:42 -0400 (EDT) Received: by vm-mail (OpenSMTPD) with ESMTPSA id c7af31df (TLSv1.3:TLS_AES_256_GCM_SHA384:256:NO); Wed, 2 Oct 2024 15:14:51 +0000 (UTC) Date: Wed, 2 Oct 2024 17:15:39 +0200 From: Patrick Steinhardt To: git@vger.kernel.org Cc: Eli Schwartz Subject: [RFC PATCH 02/21] t/test-lib: fix quoting of TEST_RESULTS_SAN_FILE Message-ID: <559b593b5982391c42ad2457435a5667fb3b495b.1727881164.git.ps@pks.im> References: Precedence: bulk X-Mailing-List: git@vger.kernel.org List-Id: List-Subscribe: List-Unsubscribe: MIME-Version: 1.0 Content-Disposition: inline In-Reply-To: When assembling our LSAN_OPTIONS that configure the leak sanitizer we end up prepending the string with various different colon-separated options via calls to `prepend_var`. One of the settings we add is the path where the sanitizer should store logs, which can be an arbitrary filesystem path. Naturally, filesystem paths may contain whitespace characters. And while it does seem as if we were quoting the value, we use escaped quotes and consequently split up the value if it does contain spaces. This leads to the following error in t0000 when having a value with whitespaces: .../t/test-lib.sh: eval: line 64: unexpected EOF while looking for matching `"' ++ return 1 error: last command exited with $?=1 not ok 5 - subtest: 3 passing tests The error itself is a bit puzzling at first. The basic problem is that the code sees the leading escaped quote during eval, but because we truncate everything after the space character it doesn't see the trailing escaped quote and thus fails to parse the string. Properly quote the value to fix the issue while using single-quotes to quote the inner value passed to eval. The issue can be reproduced by t0000 with such a path that contains spaces. Signed-off-by: Patrick Steinhardt --- t/test-lib.sh | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) diff --git a/t/test-lib.sh b/t/test-lib.sh index e718efe4c6..5de93911b9 100644 --- a/t/test-lib.sh +++ b/t/test-lib.sh @@ -1601,7 +1601,7 @@ then prepend_var LSAN_OPTIONS : dedup_token_length=9999 prepend_var LSAN_OPTIONS : log_exe_name=1 - prepend_var LSAN_OPTIONS : log_path=\"$TEST_RESULTS_SAN_FILE\" + prepend_var LSAN_OPTIONS : log_path="'$TEST_RESULTS_SAN_FILE'" export LSAN_OPTIONS elif test "$GIT_TEST_PASSING_SANITIZE_LEAK" = "check" || From patchwork Wed Oct 2 15:15:42 2024 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: Patrick Steinhardt X-Patchwork-Id: 13819932 Received: from fhigh-a1-smtp.messagingengine.com (fhigh-a1-smtp.messagingengine.com [103.168.172.152]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by smtp.subspace.kernel.org (Postfix) with ESMTPS id 228991D0DEB for ; Wed, 2 Oct 2024 15:15:45 +0000 (UTC) Authentication-Results: smtp.subspace.kernel.org; arc=none smtp.client-ip=103.168.172.152 ARC-Seal: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1727882147; cv=none; b=R0kclJSWV/LgCWFa4zmC2B3uOGm6xnA4CpADl6VMHMhergoJxNDXGDF2FoQpYxWNM0nPqi0pHyjtrUkEMmCRxv0No2ikq4OW770Or7yaeSrOqI8JhdbC+K+/cVozdj3MaS7thEC54CMTAAzz1kDgZOkTpfkORJbIJbcU50ZDeR4= ARC-Message-Signature: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1727882147; c=relaxed/simple; bh=x+tajcsWuWQHT7Q4jDkKxaI12eqWabEngKVF0IEbeWQ=; h=Date:From:To:Cc:Subject:Message-ID:References:MIME-Version: Content-Type:Content-Disposition:In-Reply-To; b=tY2sXtYp23RsXBXDSXHSnaGBnsMUyxpfGXDnw3HXkmnjNWsn4RnwIj++2E5Hme6Ow0J8SwbBCQBdjDqstNyDmxvcJgI/Pp4w3IVgPQNTGatl2Hp+KYr9MLN6HrcPS1ba65Fuav2lbalg+MF3a7ZMdLhYZspEeqdVm7UR7YhWsmY= ARC-Authentication-Results: i=1; smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=pks.im; spf=pass smtp.mailfrom=pks.im; dkim=pass (2048-bit key) header.d=pks.im header.i=@pks.im header.b=qw16r8Bc; dkim=pass (2048-bit key) header.d=messagingengine.com header.i=@messagingengine.com header.b=VQshqlNr; arc=none smtp.client-ip=103.168.172.152 Authentication-Results: smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=pks.im Authentication-Results: smtp.subspace.kernel.org; spf=pass smtp.mailfrom=pks.im Authentication-Results: smtp.subspace.kernel.org; dkim=pass (2048-bit key) header.d=pks.im header.i=@pks.im header.b="qw16r8Bc"; dkim=pass (2048-bit key) header.d=messagingengine.com header.i=@messagingengine.com header.b="VQshqlNr" Received: from phl-compute-07.internal (phl-compute-07.phl.internal [10.202.2.47]) by mailfhigh.phl.internal (Postfix) with ESMTP id 1DB651140176; Wed, 2 Oct 2024 11:15:45 -0400 (EDT) Received: from phl-mailfrontend-02 ([10.202.2.163]) by phl-compute-07.internal (MEProxy); Wed, 02 Oct 2024 11:15:45 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=pks.im; h=cc:cc :content-type:content-type:date:date:from:from:in-reply-to :in-reply-to:message-id:mime-version:references:reply-to:subject :subject:to:to; s=fm2; t=1727882145; x=1727968545; bh=SK7CQg8Hj8 Qrp/4+TbJpqN7dK4Ne18qRtY4x12NvmRA=; b=qw16r8BcDX54pqsmDV/xJ/xhiY hKQXTXSvFpGRB6h3v6XZOVFfUcFythI/c0Xa0v+ADtJjrCOGzkTszq9UYiGSjMkM t6a2FmPm/J17hHHrMcLjqEyEXmmAGlQKNt2liqKCW0PDXkzHgM9KLUFZ9mGG2NTD hQ1ZK1QKP4UXml6gVPLtbI7mlZyXfpReBHxkOmB4rREpOlztcHqG3INivp0yP7IE Jb5YWQU2q3X63op6zdVe8H6/2lL3nSdiTd6G76j78hhJ6R9G4g4tNHSR6jwGM3av jJCPYOCg1mSJwsAjMRuKDUrcBm7/dJ+CB605B06pQmu8jmbqMsH9ZY/HclCQ== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:cc:content-type:content-type:date:date :feedback-id:feedback-id:from:from:in-reply-to:in-reply-to :message-id:mime-version:references:reply-to:subject:subject:to :to:x-me-proxy:x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s= fm2; t=1727882145; x=1727968545; bh=SK7CQg8Hj8Qrp/4+TbJpqN7dK4Ne 18qRtY4x12NvmRA=; b=VQshqlNrhOUbM6ayLkEkmHcrfjnpHuNZci1qJoe1y8hP XJRzEoiwB/dUZoj8oObcxN/OhPweZAKOpkTQamagzeaiSEvUbZ62l/qrJVP+a7fy Xd4jaoqtCCZiU30bdx5RVb7+W3OpU5bBeB9Nrx6n4lZHJu8WFmvc0UaKID5YE+ey 9r+BmLr6cah/8qP4RBcqFxEaiXLnZ98TgGG4GNwuasIG6nsyFCU69uyySSIgwN0b ZekKJ2EAhQRqlyjzFtKDsrS6uq4eAnjZx/P/jqKny5qN4F3qDjdWVjHk/BOB9H5E qomUjQij4XINsXU2uR8eydmW3EZFvI8XL4S6KXAGrA== X-ME-Sender: X-ME-Received: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeeftddrvdduledgkedvucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfu rfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucesvcftvggtihhpihgvnh htshculddquddttddmnecujfgurhepfffhvfevuffkfhggtggujgesthdtredttddtvden ucfhrhhomheprfgrthhrihgtkhcuufhtvghinhhhrghrughtuceophhssehpkhhsrdhimh eqnecuggftrfgrthhtvghrnhepveekkeffhfeitdeludeigfejtdetvdelvdduhefgueeg udfghfeukefhjedvkedtnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehmrg hilhhfrhhomhepphhssehpkhhsrdhimhdpnhgspghrtghpthhtohepvddpmhhouggvpehs mhhtphhouhhtpdhrtghpthhtohepghhithesvhhgvghrrdhkvghrnhgvlhdrohhrghdprh gtphhtthhopegvshgthhifrghrthiisehgvghnthhoohdrohhrgh X-ME-Proxy: Feedback-ID: i197146af:Fastmail Received: by mail.messagingengine.com (Postfix) with ESMTPA; Wed, 2 Oct 2024 11:15:44 -0400 (EDT) Received: by vm-mail (OpenSMTPD) with ESMTPSA id 461fd166 (TLSv1.3:TLS_AES_256_GCM_SHA384:256:NO); Wed, 2 Oct 2024 15:14:54 +0000 (UTC) Date: Wed, 2 Oct 2024 17:15:42 +0200 From: Patrick Steinhardt To: git@vger.kernel.org Cc: Eli Schwartz Subject: [RFC PATCH 03/21] t/lib-gitweb: test against the build version of gitweb Message-ID: References: Precedence: bulk X-Mailing-List: git@vger.kernel.org List-Id: List-Subscribe: List-Unsubscribe: MIME-Version: 1.0 Content-Disposition: inline In-Reply-To: When testing gitweb we set up the CGI script as "gitweb.perl", which is the source file of the build target "gitweb.cgi". This works alright as long as we run in-tree tests. But we're about to make out-of-tree tests a reality, and there things will break because "gitweb.perl" will not be found in the build directory. Fix this by using "gitweb.cgi" instead. Signed-off-by: Patrick Steinhardt --- t/lib-gitweb.sh | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) diff --git a/t/lib-gitweb.sh b/t/lib-gitweb.sh index 1f32ca66ea..c64c87fb87 100644 --- a/t/lib-gitweb.sh +++ b/t/lib-gitweb.sh @@ -49,7 +49,7 @@ EOF error "Cannot find gitweb at $GITWEB_TEST_INSTALLED." say "# Testing $SCRIPT_NAME" else # normal case, use source version of gitweb - SCRIPT_NAME="$GIT_BUILD_DIR/gitweb/gitweb.perl" + SCRIPT_NAME="$GIT_BUILD_DIR/gitweb/gitweb.cgi" fi export SCRIPT_NAME } From patchwork Wed Oct 2 15:15:44 2024 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: Patrick Steinhardt X-Patchwork-Id: 13819933 Received: from fhigh-a1-smtp.messagingengine.com (fhigh-a1-smtp.messagingengine.com [103.168.172.152]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by smtp.subspace.kernel.org (Postfix) with ESMTPS id 2D6201D0F4F for ; Wed, 2 Oct 2024 15:15:48 +0000 (UTC) Authentication-Results: smtp.subspace.kernel.org; arc=none smtp.client-ip=103.168.172.152 ARC-Seal: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1727882150; cv=none; b=O6gdVQP1pCb53e6YUkGN1T7wcQvn67Z9yFbSyu259nr/ycb68OlgEgSMXuOeHOjnTebSDS5kRovpeqRqdbZn7GYLrf4A7Ah5Ruio8+2SZFGVjYhGahZuvjeRO+mgtmUC/Fl3GohmzEMsf59f1ARkpfDLPe6YIzaN/cnV3+TQ28I= ARC-Message-Signature: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1727882150; c=relaxed/simple; bh=eVbs43NP1mC4RM7R5pXL1zG99WYwhezPLboaG9ADTHI=; h=Date:From:To:Cc:Subject:Message-ID:References:MIME-Version: Content-Type:Content-Disposition:In-Reply-To; b=QJgCSxpkT068GzmIpKYdmngJht+FyN82i/2hmpmDhUgW48fIZHIOIPGKKA0iVu/3wnNRECQDAEl0pNVL0Sl7wMMS1DIbgEH3T8KNZ3iwfxORexc5aZTg70bo4s5ZBLgKfO+c5B69m1OUOJwC5XWA99OMQNEUA7MAQ375Tp3PZ+c= ARC-Authentication-Results: i=1; smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=pks.im; spf=pass smtp.mailfrom=pks.im; dkim=pass (2048-bit key) header.d=pks.im header.i=@pks.im header.b=da097Ljm; dkim=pass (2048-bit key) header.d=messagingengine.com header.i=@messagingengine.com header.b=oISwTtCb; arc=none smtp.client-ip=103.168.172.152 Authentication-Results: smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=pks.im Authentication-Results: smtp.subspace.kernel.org; spf=pass smtp.mailfrom=pks.im Authentication-Results: smtp.subspace.kernel.org; dkim=pass (2048-bit key) header.d=pks.im header.i=@pks.im header.b="da097Ljm"; dkim=pass (2048-bit key) header.d=messagingengine.com header.i=@messagingengine.com header.b="oISwTtCb" Received: from phl-compute-10.internal (phl-compute-10.phl.internal [10.202.2.50]) by mailfhigh.phl.internal (Postfix) with ESMTP id 30A531140185; Wed, 2 Oct 2024 11:15:48 -0400 (EDT) Received: from phl-mailfrontend-02 ([10.202.2.163]) by phl-compute-10.internal (MEProxy); Wed, 02 Oct 2024 11:15:48 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=pks.im; h=cc:cc :content-type:content-type:date:date:from:from:in-reply-to :in-reply-to:message-id:mime-version:references:reply-to:subject :subject:to:to; s=fm2; t=1727882148; x=1727968548; bh=WkxW6K+UbP Ihpy+k7WTWT4mYjjU68qRJkwtsc/Quf+k=; b=da097LjmUkuQ0Gw4GFpY5vlE88 Gp6ACdFl3icIPwPU58EowEOI0NxkmLAMIlWJ6io4B0IyevIrYS+2DdFbFftSgVc1 mBMDkro8Lhp6ZAyHCJu9fHTcTaLm9ZzXym4e29luxjkaMSrA6S6m8aUDcwj1plV/ n6A9wOfQssDSYWbrhRtJ6euxyWEncHks+Rj0FOaZClblpgbND3LfZYSzDEL8okYq uwAZeU0XuRxdwkJSkOjFH9iMxoGicilCO8WuCyCT4LiQUeRX3HM4u8WiUAIojPCw d11kQulW2nxFphXukgb9ZLko+X76AvkKTy/tWBRKiI5F/8rPAAT9997B62lA== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:cc:content-type:content-type:date:date :feedback-id:feedback-id:from:from:in-reply-to:in-reply-to :message-id:mime-version:references:reply-to:subject:subject:to :to:x-me-proxy:x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s= fm2; t=1727882148; x=1727968548; bh=WkxW6K+UbPIhpy+k7WTWT4mYjjU6 8qRJkwtsc/Quf+k=; b=oISwTtCbZqsLcopvzNWngvIFYYBebFR2PUYw2nEz+30i r1H2H/KErJJ8cK/c3maHUs3fCV/NvBLrHy7qrKm2BhKaQ6viiMoQBYpcVcO9QjxR J5pDJFgRF2KGMpcD4pet8B4DoJmrCAxOTQRsD4QpIqqKAEE9SeRwaQRO+8OtlN6Z RjC9AcysSCJUPx9cI8FPjdb2G364Hsw/raew3oVkYLvk+mjW9OjWg8dyNNpk81Tf zpM+s9VN79jP2gClS5Hy81OgwecSwFZGzNMGsM5wzGTwMfDVmjei7eLrNZ078Z7y SV0uXlyEMdUPyhBveL/s6ovQ2IflMRrthVsWloVixA== X-ME-Sender: X-ME-Received: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeeftddrvdduledgkeefucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfu rfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucesvcftvggtihhpihgvnh htshculddquddttddmnecujfgurhepfffhvfevuffkfhggtggujgesthdtredttddtvden ucfhrhhomheprfgrthhrihgtkhcuufhtvghinhhhrghrughtuceophhssehpkhhsrdhimh eqnecuggftrfgrthhtvghrnhepveekkeffhfeitdeludeigfejtdetvdelvdduhefgueeg udfghfeukefhjedvkedtnecuvehluhhsthgvrhfuihiivgepudenucfrrghrrghmpehmrg hilhhfrhhomhepphhssehpkhhsrdhimhdpnhgspghrtghpthhtohepvddpmhhouggvpehs mhhtphhouhhtpdhrtghpthhtohepvghstghhfigrrhhtiiesghgvnhhtohhordhorhhgpd hrtghpthhtohepghhithesvhhgvghrrdhkvghrnhgvlhdrohhrgh X-ME-Proxy: Feedback-ID: i197146af:Fastmail Received: by mail.messagingengine.com (Postfix) with ESMTPA; Wed, 2 Oct 2024 11:15:47 -0400 (EDT) Received: by vm-mail (OpenSMTPD) with ESMTPSA id 8db4104b (TLSv1.3:TLS_AES_256_GCM_SHA384:256:NO); Wed, 2 Oct 2024 15:14:57 +0000 (UTC) Date: Wed, 2 Oct 2024 17:15:44 +0200 From: Patrick Steinhardt To: git@vger.kernel.org Cc: Eli Schwartz Subject: [RFC PATCH 04/21] t/lib-gpg: fix setup of GNUPGHOME in MinGW Message-ID: References: Precedence: bulk X-Mailing-List: git@vger.kernel.org List-Id: List-Subscribe: List-Unsubscribe: MIME-Version: 1.0 Content-Disposition: inline In-Reply-To: In "t/lib-gpg.sh" we set up the "GNUPGHOME" environment variable to point to a test-specific diretcory. This is done by using "$PWD/gpghome" as value, where "$PWD" is the current test's trash directory. This is broken for MinGW though because "$PWD" will use Windows-style paths that contain drive letters. What we really want in this context is a Unix-style path, which we can get by using `$(pwd)` instead. Adapt the code accordingly to fix tests using this library. Signed-off-by: Patrick Steinhardt --- t/lib-gpg.sh | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) diff --git a/t/lib-gpg.sh b/t/lib-gpg.sh index add11e88fc..3845b6ac44 100644 --- a/t/lib-gpg.sh +++ b/t/lib-gpg.sh @@ -6,7 +6,7 @@ # executed in an eval'ed subshell that changes the working directory to a # temporary one. -GNUPGHOME="$PWD/gpghome" +GNUPGHOME="$(pwd)/gpghome" export GNUPGHOME test_lazy_prereq GPG ' From patchwork Wed Oct 2 15:15:47 2024 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: Patrick Steinhardt X-Patchwork-Id: 13819934 Received: from fhigh-a1-smtp.messagingengine.com (fhigh-a1-smtp.messagingengine.com [103.168.172.152]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by smtp.subspace.kernel.org (Postfix) with ESMTPS id 35BB41D12E2 for ; Wed, 2 Oct 2024 15:15:51 +0000 (UTC) Authentication-Results: smtp.subspace.kernel.org; arc=none smtp.client-ip=103.168.172.152 ARC-Seal: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1727882153; cv=none; b=sJac4EimTRIbG0un8hs0/NyviH2M/HhuPV8dB1IuKRW97+dVE2fSJIWTfria/kNyBYGwauCgyFSvFsJY8VwCsQ5dapkS/szIjNPjnlV4qK0J7f10yxJJ4GpsJLX9pSOnZDd9Bs0R8CfCV7bSFvlGkaoO5YCan2jwdGO0jDHL5oY= ARC-Message-Signature: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1727882153; c=relaxed/simple; bh=/jUPGf2+33Ex5BXMDpZWACa9853/5uZx94/wfQ3n2JA=; h=Date:From:To:Cc:Subject:Message-ID:References:MIME-Version: Content-Type:Content-Disposition:In-Reply-To; b=O1fOaxh7TqITcOTS+dh3zAaCGkeJWcrJnBctJTziKxQ0spS0IxXB7E9jshf2JfSPfXiazP/xYpA7f6yZyZ/9+rucL3rQfv40jw6iigeH9ko2O9jJcQ8P0GqWo3fWGJ7ZKAx0bKgh2l47CyTu5pNQr4aVoUhDgYVVkxd1ZuHZYHo= ARC-Authentication-Results: i=1; smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=pks.im; spf=pass smtp.mailfrom=pks.im; dkim=pass (2048-bit key) header.d=pks.im header.i=@pks.im header.b=cVQHXQ46; dkim=pass (2048-bit key) header.d=messagingengine.com header.i=@messagingengine.com header.b=RMX1MNJE; arc=none smtp.client-ip=103.168.172.152 Authentication-Results: smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=pks.im Authentication-Results: smtp.subspace.kernel.org; spf=pass smtp.mailfrom=pks.im Authentication-Results: smtp.subspace.kernel.org; dkim=pass (2048-bit key) header.d=pks.im header.i=@pks.im header.b="cVQHXQ46"; dkim=pass (2048-bit key) header.d=messagingengine.com header.i=@messagingengine.com header.b="RMX1MNJE" Received: from phl-compute-07.internal (phl-compute-07.phl.internal [10.202.2.47]) by mailfhigh.phl.internal (Postfix) with ESMTP id 5CB801140185; Wed, 2 Oct 2024 11:15:51 -0400 (EDT) Received: from phl-mailfrontend-02 ([10.202.2.163]) by phl-compute-07.internal (MEProxy); Wed, 02 Oct 2024 11:15:51 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=pks.im; h=cc:cc :content-type:content-type:date:date:from:from:in-reply-to :in-reply-to:message-id:mime-version:references:reply-to:subject :subject:to:to; s=fm2; t=1727882151; x=1727968551; bh=SrEiT2kY8D Puu81dimq02V8vxJ9z1CpQ9d7YfE574IY=; b=cVQHXQ46R8Ap2ZGWnmvSvnP1O3 0vNHnHnbycNZlI5NVKwBrbCdiYAVDcNiDHnbwmBueqC4Mr9yZffOel4S+0LCyAAG 7ASKqSrL+gBTFdV+TwbqGGRHwGaTYt4HXNM0s72DYbYH/vuxDfp8z81sQLJrWwxf 9DsVKjruzC/qSTyhs4D1zZj6rxWFLH8e6Cdn7sYWYaDf0ziHltoO/Ur5zpC+5wQw CIJjM1na4Uv7cxbR1pIOOlPMowtyb6C0GklbsTNLCeq9ZR6IKvrKMeT8vBdzoWX+ CxC9bO8k/WFNwcifBUWLSOM5UWsn29q//ykSC+yBWvVEIzcdK3d4VHCfNlhw== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:cc:content-type:content-type:date:date :feedback-id:feedback-id:from:from:in-reply-to:in-reply-to :message-id:mime-version:references:reply-to:subject:subject:to :to:x-me-proxy:x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s= fm2; t=1727882151; x=1727968551; bh=SrEiT2kY8DPuu81dimq02V8vxJ9z 1CpQ9d7YfE574IY=; b=RMX1MNJEWe0DDvmVB7C9Nsdsp60Lgc7sg0PzdTVoPTb4 92TPRCNV6EmJ6ew5B3HSUGntriL4Kh8/AvkSEA0mQpeJ65voE2ap2dVxwl3+Ul6c JHZBZ8VjAGa5QwDOocn36w0JKQVJ5arV4fGmwDfwH7unCqa0HoHR+SJRSMiEsM1r FL1YX141d1oISnjy3EDTrUa4Gdx/k8J6mDumSWMQKyn8pZ2zw+mU92u0jRFmz41z b4nEzT8KuBpmMX30tHf8YywxAjUe/Uywzru56fxsGeIHP0NAT2R3EIZ9H1T8KCoZ jdpfQBI0vbG+TcMtXw31AV6EndWZXND6hvnFOBJHRw== X-ME-Sender: X-ME-Received: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeeftddrvdduledgkedvucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfu rfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucesvcftvggtihhpihgvnh htshculddquddttddmnecujfgurhepfffhvfevuffkfhggtggujgesthdtredttddtvden ucfhrhhomheprfgrthhrihgtkhcuufhtvghinhhhrghrughtuceophhssehpkhhsrdhimh eqnecuggftrfgrthhtvghrnhepveekkeffhfeitdeludeigfejtdetvdelvdduhefgueeg udfghfeukefhjedvkedtnecuvehluhhsthgvrhfuihiivgepudenucfrrghrrghmpehmrg hilhhfrhhomhepphhssehpkhhsrdhimhdpnhgspghrtghpthhtohepvddpmhhouggvpehs mhhtphhouhhtpdhrtghpthhtohepvghstghhfigrrhhtiiesghgvnhhtohhordhorhhgpd hrtghpthhtohepghhithesvhhgvghrrdhkvghrnhgvlhdrohhrgh X-ME-Proxy: Feedback-ID: i197146af:Fastmail Received: by mail.messagingengine.com (Postfix) with ESMTPA; Wed, 2 Oct 2024 11:15:50 -0400 (EDT) Received: by vm-mail (OpenSMTPD) with ESMTPSA id 4fe1bd6f (TLSv1.3:TLS_AES_256_GCM_SHA384:256:NO); Wed, 2 Oct 2024 15:14:59 +0000 (UTC) Date: Wed, 2 Oct 2024 17:15:47 +0200 From: Patrick Steinhardt To: git@vger.kernel.org Cc: Eli Schwartz Subject: [RFC PATCH 05/21] t3404: work around platform-specific behaviour on macOS 10.15 Message-ID: <00fd829833cae1d192d6c42237aa13427156e3ea.1727881164.git.ps@pks.im> References: Precedence: bulk X-Mailing-List: git@vger.kernel.org List-Id: List-Subscribe: List-Unsubscribe: MIME-Version: 1.0 Content-Disposition: inline In-Reply-To: Two of our tests in t3404 use indented HERE docs where leading tabs on some of the lines are actually relevant. The tabs do get removed though, and we try to fix this up by using sed(1) to replace leading tabs in the actual output, as well. But on macOS 10.15 this doesn't work as expected and we somehow keep the tabs around in the actual output. Work around this issue by retaining the tabs. Signed-off-by: Patrick Steinhardt --- t/t3404-rebase-interactive.sh | 38 +++++++++++++++++------------------ 1 file changed, 18 insertions(+), 20 deletions(-) diff --git a/t/t3404-rebase-interactive.sh b/t/t3404-rebase-interactive.sh index f171af3061..da4f3e6caf 100755 --- a/t/t3404-rebase-interactive.sh +++ b/t/t3404-rebase-interactive.sh @@ -1917,18 +1917,17 @@ test_expect_success '--update-refs updates refs correctly' ' test_cmp_rev HEAD~1 refs/heads/third && test_cmp_rev HEAD refs/heads/no-conflict-branch && - cat >expect <<-\EOF && - Successfully rebased and updated refs/heads/update-refs. - Updated the following refs with --update-refs: - refs/heads/first - refs/heads/no-conflict-branch - refs/heads/second - refs/heads/third - EOF + cat >expect <<\EOF && +Successfully rebased and updated refs/heads/update-refs. +Updated the following refs with --update-refs: + refs/heads/first + refs/heads/no-conflict-branch + refs/heads/second + refs/heads/third +EOF # Clear "Rebasing (X/Y)" progress lines and drop leading tabs. - sed -e "s/Rebasing.*Successfully/Successfully/g" -e "s/^\t//g" \ - err.trimmed && + sed "s/Rebasing.*Successfully/Successfully/g" err.trimmed && test_cmp expect err.trimmed ' @@ -2178,19 +2177,18 @@ test_expect_success '--update-refs: check failed ref update' ' test_must_fail git rebase --continue 2>err && grep "update_ref failed for ref '\''refs/heads/second'\''" err && - cat >expect <<-\EOF && - Updated the following refs with --update-refs: - refs/heads/first - refs/heads/no-conflict-branch - refs/heads/third - Failed to update the following refs with --update-refs: - refs/heads/second - EOF + cat >expect <<\EOF && +Updated the following refs with --update-refs: + refs/heads/first + refs/heads/no-conflict-branch + refs/heads/third +Failed to update the following refs with --update-refs: + refs/heads/second +EOF # Clear "Rebasing (X/Y)" progress lines and drop leading tabs. tail -n 6 err >err.last && - sed -e "s/Rebasing.*Successfully/Successfully/g" -e "s/^\t//g" \ - err.trimmed && + sed "s/Rebasing.*Successfully/Successfully/g" err.trimmed && test_cmp expect err.trimmed ' From patchwork Wed Oct 2 15:15:51 2024 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: Patrick Steinhardt X-Patchwork-Id: 13819935 Received: from fout-a3-smtp.messagingengine.com (fout-a3-smtp.messagingengine.com [103.168.172.146]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by smtp.subspace.kernel.org (Postfix) with ESMTPS id 3F9831D0B91 for ; Wed, 2 Oct 2024 15:15:58 +0000 (UTC) Authentication-Results: smtp.subspace.kernel.org; arc=none smtp.client-ip=103.168.172.146 ARC-Seal: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1727882161; cv=none; b=rnWhUvzj8VPiTtf4XURk55TrtUQDakNnFl0+ZFQmFuvi6fsj0U3JTAsvMmHvTimZWTClX3mGDe0F6lDuopKqYZJ4cHqvKTU1QrL6Fuv119yypmbq4fH1Bz8DS+ynbWL5u0I7FG1cUWZd31QhtwUHDd3ltTwGrfvcKDxfynpXFNI= ARC-Message-Signature: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1727882161; c=relaxed/simple; bh=T/zDBYhz5WlqQjrpWIYpkCovFzoC2pKTyNlXDWqNj2s=; h=Date:From:To:Cc:Subject:Message-ID:References:MIME-Version: Content-Type:Content-Disposition:In-Reply-To; b=MK8xSl85+uAktB7m+5Fz73Aleo7mK4OM13nsTCiTcG8dNXN8ExVB2OkF7EwuHpROcaBJwcMfpNvGfoxqx8ttZLxDnd9hvbQPkcQfPshcM+yGOsP4NEZMdYr56Ccfq16zJCuZEV8p5/FLmwEtLiM214MNxNo1Dn7MeVxTgp7UWqk= ARC-Authentication-Results: i=1; smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=pks.im; spf=pass smtp.mailfrom=pks.im; dkim=pass (2048-bit key) header.d=pks.im header.i=@pks.im header.b=dIk/PgL0; dkim=pass (2048-bit key) header.d=messagingengine.com header.i=@messagingengine.com header.b=WlAux7aX; arc=none smtp.client-ip=103.168.172.146 Authentication-Results: smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=pks.im Authentication-Results: smtp.subspace.kernel.org; spf=pass smtp.mailfrom=pks.im Authentication-Results: smtp.subspace.kernel.org; dkim=pass (2048-bit key) header.d=pks.im header.i=@pks.im header.b="dIk/PgL0"; dkim=pass (2048-bit key) header.d=messagingengine.com header.i=@messagingengine.com header.b="WlAux7aX" Received: from phl-compute-05.internal (phl-compute-05.phl.internal [10.202.2.45]) by mailfout.phl.internal (Postfix) with ESMTP id 5C7F3138017B; Wed, 2 Oct 2024 11:15:58 -0400 (EDT) Received: from phl-mailfrontend-02 ([10.202.2.163]) by phl-compute-05.internal (MEProxy); Wed, 02 Oct 2024 11:15:58 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=pks.im; h=cc:cc :content-type:content-type:date:date:from:from:in-reply-to :in-reply-to:message-id:mime-version:references:reply-to:subject :subject:to:to; s=fm2; t=1727882158; x=1727968558; bh=BvIKHNdagj WiHhgXFdZpuqsgOVmuSgyVY43RBmQMDKU=; b=dIk/PgL0YPjYgePnvdkCCgPOq+ SvQBRGL5Z8QFkgxmIR5BxB5bi5/M/fWEtflTUJiqdfS+RH0nP1SCes+t4hSx4Fu2 TPbI3Nj3PhzTw1Fd+ofTBfAQ0Qr/0qvAz7C4gZCQ5v5vjuoTB3KEyLb7J6Pi80/F 1OZxR9CPg2KLfsP8V4suVJWY3dvgT1yRundgU0VCi7nvW+kZ/UXm747uSzErKB+5 wtZlWiEWPuu2wjt4w74gmaoamgNHCPTyoC+jMtaG/W/d7y1cIWO3uW601s1oRlur By5z/AZYh6qWwEvevSNIeHLfKAyR76DC92Mn1UT8BimHiDfCHZSwfLeCUJwg== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:cc:content-type:content-type:date:date :feedback-id:feedback-id:from:from:in-reply-to:in-reply-to :message-id:mime-version:references:reply-to:subject:subject:to :to:x-me-proxy:x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s= fm2; t=1727882158; x=1727968558; bh=BvIKHNdagjWiHhgXFdZpuqsgOVmu SgyVY43RBmQMDKU=; b=WlAux7aXOOcm7vvRYnv/O+lQDYinNPPB0hST+WTbyDvS /m+e7rgd54IJfsBJKbCshEsJD3ZX3PEUiX9vf5hBXC3X6FlgCyXjiTJqp9cmW3EL Bo7dbLXM2BLKISB4IfRDBun1wl2bMJGjRDwFD9A8uOyshKmtO+U+1YnAnOhEi9Fg bNSsCTSvl/wgwdozw7v6iK8oecw+EQFtjEkRn+Pmg2o7ft1me6jaxzLGbQBwAZj3 1kQEOF+lwOkvz3jqpuQeU6+ewGib6JmyDcFyYhFwK/PpZ7K+SEfMlK2GD8gG5YzN aMOMhL0fZC4mCDpClITo33t+oR9qp0Gwn6RUAPyZ1Q== X-ME-Sender: X-ME-Received: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeeftddrvdduledgkedvucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfu rfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucesvcftvggtihhpihgvnh htshculddquddttddmnecujfgurhepfffhvfevuffkfhggtggujgesthdtredttddtvden ucfhrhhomheprfgrthhrihgtkhcuufhtvghinhhhrghrughtuceophhssehpkhhsrdhimh eqnecuggftrfgrthhtvghrnhepveekkeffhfeitdeludeigfejtdetvdelvdduhefgueeg udfghfeukefhjedvkedtnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehmrg hilhhfrhhomhepphhssehpkhhsrdhimhdpnhgspghrtghpthhtohepvddpmhhouggvpehs mhhtphhouhhtpdhrtghpthhtohepghhithesvhhgvghrrdhkvghrnhgvlhdrohhrghdprh gtphhtthhopegvshgthhifrghrthiisehgvghnthhoohdrohhrgh X-ME-Proxy: Feedback-ID: i197146af:Fastmail Received: by mail.messagingengine.com (Postfix) with ESMTPA; Wed, 2 Oct 2024 11:15:57 -0400 (EDT) Received: by vm-mail (OpenSMTPD) with ESMTPSA id 132c2b61 (TLSv1.3:TLS_AES_256_GCM_SHA384:256:NO); Wed, 2 Oct 2024 15:15:06 +0000 (UTC) Date: Wed, 2 Oct 2024 17:15:51 +0200 From: Patrick Steinhardt To: git@vger.kernel.org Cc: Eli Schwartz Subject: [RFC PATCH 06/21] t/unit-tests: update clar unit test framework Message-ID: References: Precedence: bulk X-Mailing-List: git@vger.kernel.org List-Id: List-Subscribe: List-Unsubscribe: MIME-Version: 1.0 Content-Disposition: inline In-Reply-To: Update clar unit test framework to 67e689a (Merge pull request #103 from pks-t/pks-editorconfig, 2024-09-20). Signed-off-by: Patrick Steinhardt --- t/unit-tests/clar/.editorconfig | 13 +++ t/unit-tests/clar/.github/workflows/ci.yml | 20 +++- t/unit-tests/clar/.gitignore | 1 + t/unit-tests/clar/CMakeLists.txt | 28 ++++++ t/unit-tests/clar/clar.c | 102 +++++++++++---------- t/unit-tests/clar/clar/print.h | 11 ++- t/unit-tests/clar/clar/sandbox.h | 17 ++-- t/unit-tests/clar/clar/summary.h | 14 +-- t/unit-tests/clar/test/.gitignore | 4 - t/unit-tests/clar/test/CMakeLists.txt | 41 +++++++++ t/unit-tests/clar/test/Makefile | 39 -------- 11 files changed, 172 insertions(+), 118 deletions(-) create mode 100644 t/unit-tests/clar/.editorconfig create mode 100644 t/unit-tests/clar/.gitignore create mode 100644 t/unit-tests/clar/CMakeLists.txt delete mode 100644 t/unit-tests/clar/test/.gitignore create mode 100644 t/unit-tests/clar/test/CMakeLists.txt delete mode 100644 t/unit-tests/clar/test/Makefile diff --git a/t/unit-tests/clar/.editorconfig b/t/unit-tests/clar/.editorconfig new file mode 100644 index 0000000000..aa343a4288 --- /dev/null +++ b/t/unit-tests/clar/.editorconfig @@ -0,0 +1,13 @@ +root = true + +[*] +charset = utf-8 +insert_final_newline = true + +[*.{c,h}] +indent_style = tab +tab_width = 8 + +[CMakeLists.txt] +indent_style = tab +tab_width = 8 diff --git a/t/unit-tests/clar/.github/workflows/ci.yml b/t/unit-tests/clar/.github/workflows/ci.yml index b1ac2de460..0065843d17 100644 --- a/t/unit-tests/clar/.github/workflows/ci.yml +++ b/t/unit-tests/clar/.github/workflows/ci.yml @@ -10,14 +10,26 @@ jobs: build: strategy: matrix: - os: [ ubuntu-latest, macos-latest ] + platform: + - os: ubuntu-latest + generator: Unix Makefiles + - os: macos-latest + generator: Unix Makefiles + - os: windows-latest + generator: Visual Studio 17 2022 + - os: windows-latest + generator: MSYS Makefiles + - os: windows-latest + generator: MinGW Makefiles - runs-on: ${{ matrix.os }} + runs-on: ${{ matrix.platform.os }} steps: - name: Check out uses: actions/checkout@v2 - name: Build run: | - cd test - make + mkdir build + cd build + cmake .. -G "${{matrix.platform.generator}}" + cmake --build . diff --git a/t/unit-tests/clar/.gitignore b/t/unit-tests/clar/.gitignore new file mode 100644 index 0000000000..84c048a73c --- /dev/null +++ b/t/unit-tests/clar/.gitignore @@ -0,0 +1 @@ +/build/ diff --git a/t/unit-tests/clar/CMakeLists.txt b/t/unit-tests/clar/CMakeLists.txt new file mode 100644 index 0000000000..12d4af114f --- /dev/null +++ b/t/unit-tests/clar/CMakeLists.txt @@ -0,0 +1,28 @@ +cmake_minimum_required(VERSION 3.16..3.29) + +project(clar LANGUAGES C) + +option(BUILD_TESTS "Build test executable" ON) + +add_library(clar INTERFACE) +target_sources(clar INTERFACE + clar.c + clar.h + clar/fixtures.h + clar/fs.h + clar/print.h + clar/sandbox.h + clar/summary.h +) +set_target_properties(clar PROPERTIES + C_STANDARD 90 + C_STANDARD_REQUIRED ON + C_EXTENSIONS OFF +) + +if(CMAKE_PROJECT_NAME STREQUAL PROJECT_NAME) + include(CTest) + if(BUILD_TESTING) + add_subdirectory(test) + endif() +endif() diff --git a/t/unit-tests/clar/clar.c b/t/unit-tests/clar/clar.c index cef0f023c2..f463ee823a 100644 --- a/t/unit-tests/clar/clar.c +++ b/t/unit-tests/clar/clar.c @@ -4,7 +4,8 @@ * This file is part of clar, distributed under the ISC license. * For full terms see the included COPYING file. */ -#include + +#include #include #include #include @@ -13,6 +14,7 @@ #include #include #include +#include /* required for sandboxing */ #include @@ -61,13 +63,6 @@ # define p_snprintf snprintf # endif -# ifndef PRIuZ -# define PRIuZ "Iu" -# endif -# ifndef PRIxZ -# define PRIxZ "Ix" -# endif - # if defined(_MSC_VER) || (defined(__MINGW32__) && !defined(__MINGW64_VERSION_MAJOR)) typedef struct stat STAT_T; # else @@ -78,12 +73,6 @@ # include # define _MAIN_CC # define p_snprintf snprintf -# ifndef PRIuZ -# define PRIuZ "zu" -# endif -# ifndef PRIxZ -# define PRIxZ "zx" -# endif typedef struct stat STAT_T; #endif @@ -102,7 +91,7 @@ fixture_path(const char *base, const char *fixture_name); struct clar_error { const char *file; const char *function; - size_t line_number; + uintmax_t line_number; const char *error_msg; char *description; @@ -195,11 +184,12 @@ static void clar_print_shutdown(int test_count, int suite_count, int error_count static void clar_print_error(int num, const struct clar_report *report, const struct clar_error *error); static void clar_print_ontest(const char *suite_name, const char *test_name, int test_number, enum cl_test_status failed); static void clar_print_onsuite(const char *suite_name, int suite_index); +static void clar_print_onabortv(const char *msg, va_list argp); static void clar_print_onabort(const char *msg, ...); /* From clar_sandbox.c */ static void clar_unsandbox(void); -static int clar_sandbox(void); +static void clar_sandbox(void); /* From summary.h */ static struct clar_summary *clar_summary_init(const char *filename); @@ -218,6 +208,15 @@ static int clar_summary_shutdown(struct clar_summary *fp); _clar.trace_payload); \ } while (0) +static void clar_abort(const char *msg, ...) +{ + va_list argp; + va_start(argp, msg); + clar_print_onabortv(msg, argp); + va_end(argp); + exit(-1); +} + void cl_trace_register(cl_trace_cb *cb, void *payload) { _clar.pfn_trace_cb = cb; @@ -271,9 +270,7 @@ static double clar_time_diff(clar_time *start, clar_time *end) static void clar_time_now(clar_time *out) { - struct timezone tz; - - gettimeofday(out, &tz); + gettimeofday(out, NULL); } static double clar_time_diff(clar_time *start, clar_time *end) @@ -386,7 +383,8 @@ clar_run_suite(const struct clar_suite *suite, const char *filter) _clar.active_test = test[i].name; - report = calloc(1, sizeof(struct clar_report)); + if ((report = calloc(1, sizeof(*report))) == NULL) + clar_abort("Failed to allocate report.\n"); report->suite = _clar.active_suite; report->test = _clar.active_test; report->test_number = _clar.tests_ran; @@ -479,9 +477,10 @@ clar_parse_args(int argc, char **argv) switch (action) { case 's': { - struct clar_explicit *explicit = - calloc(1, sizeof(struct clar_explicit)); - assert(explicit); + struct clar_explicit *explicit; + + if ((explicit = calloc(1, sizeof(*explicit))) == NULL) + clar_abort("Failed to allocate explicit test.\n"); explicit->suite_idx = j; explicit->filter = argument; @@ -505,10 +504,8 @@ clar_parse_args(int argc, char **argv) } } - if (!found) { - clar_print_onabort("No suite matching '%s' found.\n", argument); - exit(-1); - } + if (!found) + clar_abort("No suite matching '%s' found.\n", argument); break; } @@ -540,11 +537,17 @@ clar_parse_args(int argc, char **argv) case 'r': _clar.write_summary = 1; free(_clar.summary_filename); - _clar.summary_filename = *(argument + 2) ? strdup(argument + 2) : NULL; + if (*(argument + 2)) { + if ((_clar.summary_filename = strdup(argument + 2)) == NULL) + clar_abort("Failed to allocate summary filename.\n"); + } else { + _clar.summary_filename = NULL; + } break; default: - assert(!"Unexpected commandline argument!"); + clar_abort("Unexpected commandline argument '%s'.\n", + argument[1]); } } } @@ -566,22 +569,18 @@ clar_test_init(int argc, char **argv) if (!_clar.summary_filename && (summary_env = getenv("CLAR_SUMMARY")) != NULL) { _clar.write_summary = 1; - _clar.summary_filename = strdup(summary_env); + if ((_clar.summary_filename = strdup(summary_env)) == NULL) + clar_abort("Failed to allocate summary filename.\n"); } if (_clar.write_summary && !_clar.summary_filename) - _clar.summary_filename = strdup("summary.xml"); + if ((_clar.summary_filename = strdup("summary.xml")) == NULL) + clar_abort("Failed to allocate summary filename.\n"); - if (_clar.write_summary && - !(_clar.summary = clar_summary_init(_clar.summary_filename))) { - clar_print_onabort("Failed to open the summary file\n"); - exit(-1); - } + if (_clar.write_summary) + _clar.summary = clar_summary_init(_clar.summary_filename); - if (clar_sandbox() < 0) { - clar_print_onabort("Failed to sandbox the test runner.\n"); - exit(-1); - } + clar_sandbox(); } int @@ -615,10 +614,9 @@ clar_test_shutdown(void) clar_unsandbox(); - if (_clar.write_summary && clar_summary_shutdown(_clar.summary) < 0) { - clar_print_onabort("Failed to write the summary file\n"); - exit(-1); - } + if (_clar.write_summary && clar_summary_shutdown(_clar.summary) < 0) + clar_abort("Failed to write the summary file '%s: %s.\n", + _clar.summary_filename, strerror(errno)); for (explicit = _clar.explicit; explicit; explicit = explicit_next) { explicit_next = explicit->next; @@ -649,7 +647,7 @@ static void abort_test(void) { if (!_clar.trampoline_enabled) { clar_print_onabort( - "Fatal error: a cleanup method raised an exception."); + "Fatal error: a cleanup method raised an exception.\n"); clar_report_errors(_clar.last_report); exit(-1); } @@ -673,7 +671,10 @@ void clar__fail( const char *description, int should_abort) { - struct clar_error *error = calloc(1, sizeof(struct clar_error)); + struct clar_error *error; + + if ((error = calloc(1, sizeof(*error))) == NULL) + clar_abort("Failed to allocate error.\n"); if (_clar.last_report->errors == NULL) _clar.last_report->errors = error; @@ -688,8 +689,9 @@ void clar__fail( error->line_number = line; error->error_msg = error_msg; - if (description != NULL) - error->description = strdup(description); + if (description != NULL && + (error->description = strdup(description)) == NULL) + clar_abort("Failed to allocate description.\n"); _clar.total_errors++; _clar.last_report->status = CL_TEST_FAILURE; @@ -798,8 +800,8 @@ void clar__assert_equal( } } } - else if (!strcmp("%"PRIuZ, fmt) || !strcmp("%"PRIxZ, fmt)) { - size_t sz1 = va_arg(args, size_t), sz2 = va_arg(args, size_t); + else if (!strcmp("%"PRIuMAX, fmt) || !strcmp("%"PRIxMAX, fmt)) { + uintmax_t sz1 = va_arg(args, uintmax_t), sz2 = va_arg(args, uintmax_t); is_equal = (sz1 == sz2); if (!is_equal) { int offset = p_snprintf(buf, sizeof(buf), fmt, sz1); diff --git a/t/unit-tests/clar/clar/print.h b/t/unit-tests/clar/clar/print.h index c17e2f693b..69d0ee967e 100644 --- a/t/unit-tests/clar/clar/print.h +++ b/t/unit-tests/clar/clar/print.h @@ -21,7 +21,7 @@ static void clar_print_clap_error(int num, const struct clar_report *report, con { printf(" %d) Failure:\n", num); - printf("%s::%s [%s:%"PRIuZ"]\n", + printf("%s::%s [%s:%"PRIuMAX"]\n", report->suite, report->test, error->file, @@ -136,7 +136,7 @@ static void clar_print_tap_ontest(const char *suite_name, const char *test_name, printf(" at:\n"); printf(" file: '"); print_escaped(error->file); printf("'\n"); - printf(" line: %" PRIuZ "\n", error->line_number); + printf(" line: %" PRIuMAX "\n", error->line_number); printf(" function: '%s'\n", error->function); printf(" ---\n"); @@ -202,10 +202,15 @@ static void clar_print_onsuite(const char *suite_name, int suite_index) PRINT(onsuite, suite_name, suite_index); } +static void clar_print_onabortv(const char *msg, va_list argp) +{ + PRINT(onabort, msg, argp); +} + static void clar_print_onabort(const char *msg, ...) { va_list argp; va_start(argp, msg); - PRINT(onabort, msg, argp); + clar_print_onabortv(msg, argp); va_end(argp); } diff --git a/t/unit-tests/clar/clar/sandbox.h b/t/unit-tests/clar/clar/sandbox.h index e25057b7c4..681a1f80f1 100644 --- a/t/unit-tests/clar/clar/sandbox.h +++ b/t/unit-tests/clar/clar/sandbox.h @@ -122,14 +122,14 @@ static int build_sandbox_path(void) if (mkdir(_clar_path, 0700) != 0) return -1; -#elif defined(__TANDEM) - if (mktemp(_clar_path) == NULL) +#elif defined(_WIN32) + if (_mktemp_s(_clar_path, sizeof(_clar_path)) != 0) return -1; if (mkdir(_clar_path, 0700) != 0) return -1; -#elif defined(_WIN32) - if (_mktemp_s(_clar_path, sizeof(_clar_path)) != 0) +#elif defined(__TANDEM) + if (mktemp(_clar_path) == NULL) return -1; if (mkdir(_clar_path, 0700) != 0) @@ -142,15 +142,14 @@ static int build_sandbox_path(void) return 0; } -static int clar_sandbox(void) +static void clar_sandbox(void) { if (_clar_path[0] == '\0' && build_sandbox_path() < 0) - return -1; + clar_abort("Failed to build sandbox path.\n"); if (chdir(_clar_path) != 0) - return -1; - - return 0; + clar_abort("Failed to change into sandbox directory '%s': %s.\n", + _clar_path, strerror(errno)); } const char *clar_sandbox_path(void) diff --git a/t/unit-tests/clar/clar/summary.h b/t/unit-tests/clar/clar/summary.h index 4dd352e28b..0d0b646fe7 100644 --- a/t/unit-tests/clar/clar/summary.h +++ b/t/unit-tests/clar/clar/summary.h @@ -66,16 +66,12 @@ struct clar_summary *clar_summary_init(const char *filename) struct clar_summary *summary; FILE *fp; - if ((fp = fopen(filename, "w")) == NULL) { - perror("fopen"); - return NULL; - } + if ((fp = fopen(filename, "w")) == NULL) + clar_abort("Failed to open the summary file '%s': %s.\n", + filename, strerror(errno)); - if ((summary = malloc(sizeof(struct clar_summary))) == NULL) { - perror("malloc"); - fclose(fp); - return NULL; - } + if ((summary = malloc(sizeof(struct clar_summary))) == NULL) + clar_abort("Failed to allocate summary.\n"); summary->filename = filename; summary->fp = fp; diff --git a/t/unit-tests/clar/test/.gitignore b/t/unit-tests/clar/test/.gitignore deleted file mode 100644 index a477d0c40c..0000000000 --- a/t/unit-tests/clar/test/.gitignore +++ /dev/null @@ -1,4 +0,0 @@ -clar.suite -.clarcache -clar_test -*.o diff --git a/t/unit-tests/clar/test/CMakeLists.txt b/t/unit-tests/clar/test/CMakeLists.txt new file mode 100644 index 0000000000..4c9012d061 --- /dev/null +++ b/t/unit-tests/clar/test/CMakeLists.txt @@ -0,0 +1,41 @@ +find_package(Python COMPONENTS Interpreter REQUIRED) + +add_custom_command(OUTPUT "${CMAKE_CURRENT_BINARY_DIR}/clar.suite" + COMMAND "${Python_EXECUTABLE}" "${CMAKE_SOURCE_DIR}/generate.py" --output "${CMAKE_CURRENT_BINARY_DIR}" + DEPENDS main.c sample.c clar_test.h + WORKING_DIRECTORY "${CMAKE_CURRENT_SOURCE_DIR}" +) + +add_executable(clar_test) +set_target_properties(clar_test PROPERTIES + C_STANDARD 90 + C_STANDARD_REQUIRED ON + C_EXTENSIONS OFF +) + +# MSVC generates all kinds of warnings. We may want to fix these in the future +# and then unconditionally treat warnings as errors. +if(NOT MSVC) + set_target_properties(clar_test PROPERTIES + COMPILE_WARNING_AS_ERROR ON + ) +endif() + +target_sources(clar_test PRIVATE + main.c + sample.c + "${CMAKE_CURRENT_BINARY_DIR}/clar.suite" +) +target_compile_definitions(clar_test PRIVATE + CLAR_FIXTURE_PATH="${CMAKE_CURRENT_SOURCE_DIR}/resources/" + _DARWIN_C_SOURCE + _POSIX_C_SOURCE=200809L +) +target_compile_options(clar_test PRIVATE + $,/W4,-Wall> +) +target_include_directories(clar_test PRIVATE + "${CMAKE_SOURCE_DIR}" + "${CMAKE_CURRENT_BINARY_DIR}" +) +target_link_libraries(clar_test clar) diff --git a/t/unit-tests/clar/test/Makefile b/t/unit-tests/clar/test/Makefile deleted file mode 100644 index 93c6b2ad32..0000000000 --- a/t/unit-tests/clar/test/Makefile +++ /dev/null @@ -1,39 +0,0 @@ -# -# Copyright (c) Vicent Marti. All rights reserved. -# -# This file is part of clar, distributed under the ISC license. -# For full terms see the included COPYING file. -# - -# -# Set up the path to the clar sources and to the fixtures directory -# -# The fixture path needs to be an absolute path so it can be used -# even after we have chdir'ed into the test directory while testing. -# -CURRENT_MAKEFILE := $(word $(words $(MAKEFILE_LIST)),$(MAKEFILE_LIST)) -TEST_DIRECTORY := $(abspath $(dir $(CURRENT_MAKEFILE))) -CLAR_PATH := $(dir $(TEST_DIRECTORY)) -CLAR_FIXTURE_PATH := $(TEST_DIRECTORY)/resources/ - -CFLAGS=-g -I.. -I. -Wall -DCLAR_FIXTURE_PATH=\"$(CLAR_FIXTURE_PATH)\" - -.PHONY: clean - -# list the objects that go into our test -objects = main.o sample.o - -# build the test executable itself -clar_test: $(objects) clar_test.h clar.suite $(CLAR_PATH)clar.c - $(CC) $(CFLAGS) -o $@ "$(CLAR_PATH)clar.c" $(objects) - -# test object files depend on clar macros -$(objects) : $(CLAR_PATH)clar.h - -# build the clar.suite file of test metadata -clar.suite: - python "$(CLAR_PATH)generate.py" . - -# remove all generated files -clean: - $(RM) -rf *.o clar.suite .clarcache clar_test clar_test.dSYM From patchwork Wed Oct 2 15:15:57 2024 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: Patrick Steinhardt X-Patchwork-Id: 13819936 Received: from fout-a3-smtp.messagingengine.com (fout-a3-smtp.messagingengine.com [103.168.172.146]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by smtp.subspace.kernel.org (Postfix) with ESMTPS id 702DD1CFEBA for ; Wed, 2 Oct 2024 15:16:01 +0000 (UTC) Authentication-Results: smtp.subspace.kernel.org; arc=none smtp.client-ip=103.168.172.146 ARC-Seal: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1727882162; cv=none; b=C4ZEoisouVKgEWsbTy1p8GKPPMQH0qmbcro5LBKiL/YM+OkYZC+qOyl2F8oeN3jnNki9dlDyTIHu05wLoHeTKBo4ywGTC2+OxatQay7/mIg6PxsxKYDGCcGrpzoXcc068f8Adwb7UKyA2ZDgSlGedPDTOQsVRCcni/Xojtf3bYw= ARC-Message-Signature: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1727882162; c=relaxed/simple; bh=1zYUMZZZVO774KoBnZgPv/Z3CYUyDD31Nbuj23SWoAs=; h=Date:From:To:Cc:Subject:Message-ID:References:MIME-Version: Content-Type:Content-Disposition:In-Reply-To; b=FceiwvtTbrp7oCOXLjCLW8BWM+3I3T0uORYI0UK5tUQmTSj0T/+zGnz5zZ2GwV0YLvJW9fJuIEumgV8FbdRmbHriZZU5mdXIJx1ur/TlRDH2gX8qg6kzSfOBtWlIH0a9lB09w1CdJ6YQM1h/jVYM650yZHn1XZNzM/ToAOy8Ktc= ARC-Authentication-Results: i=1; smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=pks.im; spf=pass smtp.mailfrom=pks.im; dkim=pass (2048-bit key) header.d=pks.im header.i=@pks.im header.b=atjx4tS5; dkim=pass (2048-bit key) header.d=messagingengine.com header.i=@messagingengine.com header.b=EVlzmegR; arc=none smtp.client-ip=103.168.172.146 Authentication-Results: smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=pks.im Authentication-Results: smtp.subspace.kernel.org; spf=pass smtp.mailfrom=pks.im Authentication-Results: smtp.subspace.kernel.org; dkim=pass (2048-bit key) header.d=pks.im header.i=@pks.im header.b="atjx4tS5"; dkim=pass (2048-bit key) header.d=messagingengine.com header.i=@messagingengine.com header.b="EVlzmegR" Received: from phl-compute-12.internal (phl-compute-12.phl.internal [10.202.2.52]) by mailfout.phl.internal (Postfix) with ESMTP id 7A33F13801FA; Wed, 2 Oct 2024 11:16:00 -0400 (EDT) Received: from phl-mailfrontend-02 ([10.202.2.163]) by phl-compute-12.internal (MEProxy); Wed, 02 Oct 2024 11:16:00 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=pks.im; h=cc:cc :content-type:content-type:date:date:from:from:in-reply-to :in-reply-to:message-id:mime-version:references:reply-to:subject :subject:to:to; s=fm2; t=1727882160; x=1727968560; bh=Pq5Y5/+yhg iJ3+uTkENsfk3v5Nnyohvrl1LN1Xo4hdE=; b=atjx4tS50TI+u+ahc989o74hVy aldD4mB1Xl6+n4aG8285SiTWT84Qtkn08rBtxA+69s6kz9qPBRtkQL+gDC9x7KWt 6QI6jc5gBNjlOWlva+e1MnpqSUorYbClGwBXhpK45MupXRLU/xLcWx+Pm0HbpCkH n9BlCwFjiLPYviH8iIy14PRJKphLx0Tb/DHa9QhiNQW4I/3PdTK4dWWP5E4PMOhF ZqIrP51+d6WgpjjZ6fqqkTDnu3eDY5Q0CDB2SxryEelZUdFORCo8mUHACyiPxXzN 4Tj5WBbzYjv0f6wPxg3W5rpjatyY5nj5lqVmEqjhK5QwRSiMXGYmQZXBxigg== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:cc:content-type:content-type:date:date :feedback-id:feedback-id:from:from:in-reply-to:in-reply-to :message-id:mime-version:references:reply-to:subject:subject:to :to:x-me-proxy:x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s= fm2; t=1727882160; x=1727968560; bh=Pq5Y5/+yhgiJ3+uTkENsfk3v5Nny ohvrl1LN1Xo4hdE=; b=EVlzmegRy9SRDhqwrwiq6KLN5F6XOS9bJK+hE4NXpRHK xQn0j8sWfYM57ywzgjA7SfZKvGX4CYB3/otcT/TfLfe997kXfCcvO2baH7ZUsZkt CQWAuSusJ505Ubl1iSIRIvMKVj1TQDwDhy9+eUEWNUCVNgu0n9L2zCObtT18mbJ0 wFCzX9tskLfJKVOWqAvmruIrPYTeajQOUXvBBU95HwHCNErYtmpLf+dk/aA2D4mv cY3wxpsqDd4kpBgm5d9q2O1axTJD8ZVBddaSJlBCaxEVamIZ/tsAs/kV8EgmnZL6 mQbrDK911wFdd05+e1/aSYK93mM/f+iKoxfrWNNHMw== X-ME-Sender: X-ME-Received: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeeftddrvdduledgkeefucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfu rfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucesvcftvggtihhpihgvnh htshculddquddttddmnecujfgurhepfffhvfevuffkfhggtggujgesthdtredttddtvden ucfhrhhomheprfgrthhrihgtkhcuufhtvghinhhhrghrughtuceophhssehpkhhsrdhimh eqnecuggftrfgrthhtvghrnhepveekkeffhfeitdeludeigfejtdetvdelvdduhefgueeg udfghfeukefhjedvkedtnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehmrg hilhhfrhhomhepphhssehpkhhsrdhimhdpnhgspghrtghpthhtohepvddpmhhouggvpehs mhhtphhouhhtpdhrtghpthhtohepghhithesvhhgvghrrdhkvghrnhgvlhdrohhrghdprh gtphhtthhopegvshgthhifrghrthiisehgvghnthhoohdrohhrgh X-ME-Proxy: Feedback-ID: i197146af:Fastmail Received: by mail.messagingengine.com (Postfix) with ESMTPA; Wed, 2 Oct 2024 11:15:59 -0400 (EDT) Received: by vm-mail (OpenSMTPD) with ESMTPSA id 1723ff60 (TLSv1.3:TLS_AES_256_GCM_SHA384:256:NO); Wed, 2 Oct 2024 15:15:09 +0000 (UTC) Date: Wed, 2 Oct 2024 17:15:57 +0200 From: Patrick Steinhardt To: git@vger.kernel.org Cc: Eli Schwartz Subject: [RFC PATCH 07/21] t/clar: simplify how the clar derives `struct stat` Message-ID: References: Precedence: bulk X-Mailing-List: git@vger.kernel.org List-Id: List-Subscribe: List-Unsubscribe: MIME-Version: 1.0 Content-Disposition: inline In-Reply-To: Windows has different definitions of `struct stat`. The difference between those structs is that they either use 32 or 64 bit timestamps and/or filesizes. In the clar we try to set that up automatically, but the logic to do so is somewhat convoluted and really fragile. Refactor the code such that we always define the `stat()` function and its structure together, which is both easier to understand and less fragile. Signed-off-by: Patrick Steinhardt --- t/unit-tests/clar/clar.c | 9 +++------ 1 file changed, 3 insertions(+), 6 deletions(-) diff --git a/t/unit-tests/clar/clar.c b/t/unit-tests/clar/clar.c index f463ee823a..12fa66d088 100644 --- a/t/unit-tests/clar/clar.c +++ b/t/unit-tests/clar/clar.c @@ -30,6 +30,9 @@ # ifndef stat # define stat(path, st) _stat(path, st) + typedef struct _stat STAT_T; +# else + typedef struct stat STAT_T; # endif # ifndef mkdir # define mkdir(path, mode) _mkdir(path) @@ -62,12 +65,6 @@ # else # define p_snprintf snprintf # endif - -# if defined(_MSC_VER) || (defined(__MINGW32__) && !defined(__MINGW64_VERSION_MAJOR)) - typedef struct stat STAT_T; -# else - typedef struct _stat STAT_T; -# endif #else # include /* waitpid(2) */ # include From patchwork Wed Oct 2 15:16:00 2024 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: Patrick Steinhardt X-Patchwork-Id: 13819937 Received: from fout-a3-smtp.messagingengine.com (fout-a3-smtp.messagingengine.com [103.168.172.146]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by smtp.subspace.kernel.org (Postfix) with ESMTPS id 65D9D1D130C for ; Wed, 2 Oct 2024 15:16:04 +0000 (UTC) Authentication-Results: smtp.subspace.kernel.org; arc=none smtp.client-ip=103.168.172.146 ARC-Seal: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1727882165; cv=none; b=mSjFF4Vf6Sr2oyjJlBVO7Bo5bMO/u+Ar9uMK3lRLMGYv2pnn5WB1RMlh0+4T+3u77FmAgNNka7nrcIMPXbdvPlnVlQ2P/vqxsHvcovsnnYCgET6BnG/R+tCD9lFOtHKNTDgg1O0kvBgOD5DD+C47wvCVwuM8ZCQ/W259CbGD5e4= ARC-Message-Signature: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1727882165; c=relaxed/simple; bh=f95UTIwt8t7uQeU96cETUzINe6UYvF7DEQElrpalhJs=; h=Date:From:To:Cc:Subject:Message-ID:References:MIME-Version: Content-Type:Content-Disposition:In-Reply-To; b=oXdN0wDCMAtr0I882LueiCxb+pyHrlmik59tW9nIu5Y/uv+TsCnYam9AFY4qbtguLRliQjAtShgskuvBZV+f3+QaoDfa+BeHzNrvvL1FEkYOE+4JUEnDgqgEJejkVyDmBxV+s9vtHfcohziC6RqzwMcamN8MZxcdjdlw52lyu4Q= ARC-Authentication-Results: i=1; smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=pks.im; spf=pass smtp.mailfrom=pks.im; dkim=pass (2048-bit key) header.d=pks.im header.i=@pks.im header.b=gCvhjP3b; dkim=pass (2048-bit key) header.d=messagingengine.com header.i=@messagingengine.com header.b=RphDSqny; arc=none smtp.client-ip=103.168.172.146 Authentication-Results: smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=pks.im Authentication-Results: smtp.subspace.kernel.org; spf=pass smtp.mailfrom=pks.im Authentication-Results: smtp.subspace.kernel.org; dkim=pass (2048-bit key) header.d=pks.im header.i=@pks.im header.b="gCvhjP3b"; dkim=pass (2048-bit key) header.d=messagingengine.com header.i=@messagingengine.com header.b="RphDSqny" Received: from phl-compute-10.internal (phl-compute-10.phl.internal [10.202.2.50]) by mailfout.phl.internal (Postfix) with ESMTP id 84411138017B; Wed, 2 Oct 2024 11:16:03 -0400 (EDT) Received: from phl-mailfrontend-02 ([10.202.2.163]) by phl-compute-10.internal (MEProxy); Wed, 02 Oct 2024 11:16:03 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=pks.im; h=cc:cc :content-type:content-type:date:date:from:from:in-reply-to :in-reply-to:message-id:mime-version:references:reply-to:subject :subject:to:to; s=fm2; t=1727882163; x=1727968563; bh=N4O17Tch5m 2ACD3nyl3e157QJGqhaF/9S28wrCBxjHo=; b=gCvhjP3bQnbLEGkYSVEDEyui7E ZolrlpOP4OG3+2uqFnhgpJwA/W4G2HXdsu6wPSsWpxB/xoXRVx5A7PAAizYegO6i jB8PpnJ5AkSBS5rwAuywfcarOsCKAhEbReRinv3LzdwU5mDldWtOCH1nnRSjgPbC 6GBRAvfKmlyXpNkVJWNP9Jfwk0dw5ce7b8ktiK93qlZOjf27dfF0wTuIsC5Tyrv2 uiS2ZTt1QxHP7sjnyeSdi4U5AB7sgio1x6IP7z/2BFaNYpPiZ2Lu0a8+B3z5pdhL moasINRC1sulukI2iIYiFcC+7RrkBDEqCcjbG8FiqoSgzz5xD4gzy2aDvY+w== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:cc:content-type:content-type:date:date :feedback-id:feedback-id:from:from:in-reply-to:in-reply-to :message-id:mime-version:references:reply-to:subject:subject:to :to:x-me-proxy:x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s= fm2; t=1727882163; x=1727968563; bh=N4O17Tch5m2ACD3nyl3e157QJGqh aF/9S28wrCBxjHo=; b=RphDSqnyAkpjA8g4TzAxqO1vXtaW4tTB/UUJrNhImV5I UTAhITypy5Vh9juyworYh3u9k4UR52E9fouqSghRthVaPyUMpvIcCAEtRFMxtzrQ 7WiW3eSMk88WExSZ1tOzgNRFkYADvSbnDz4tsKe3UnjGUSpoHg8ZBOw2XeOdUo1q Xf4PREEyLIJ03DL62WzakuZoc7PzeAGGtUVnzlmE/VXM2MRzSpOCy8rXlmavRz9/ o04Nwi+hHYoEUB9SGRLcqX5Op0IyAzle9t2SU1oH5gd0PTAjtSIZT2zrox4BJgNo xA/h6BgXvf3hcKeHZLVgY+Nd4SfyekzrREeuI02ztA== X-ME-Sender: X-ME-Received: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeeftddrvdduledgkeefucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfu rfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucesvcftvggtihhpihgvnh htshculddquddttddmnecujfgurhepfffhvfevuffkfhggtggujgesthdtredttddtvden ucfhrhhomheprfgrthhrihgtkhcuufhtvghinhhhrghrughtuceophhssehpkhhsrdhimh eqnecuggftrfgrthhtvghrnhepveekkeffhfeitdeludeigfejtdetvdelvdduhefgueeg udfghfeukefhjedvkedtnecuvehluhhsthgvrhfuihiivgepvdenucfrrghrrghmpehmrg hilhhfrhhomhepphhssehpkhhsrdhimhdpnhgspghrtghpthhtohepvddpmhhouggvpehs mhhtphhouhhtpdhrtghpthhtohepvghstghhfigrrhhtiiesghgvnhhtohhordhorhhgpd hrtghpthhtohepghhithesvhhgvghrrdhkvghrnhgvlhdrohhrgh X-ME-Proxy: Feedback-ID: i197146af:Fastmail Received: by mail.messagingengine.com (Postfix) with ESMTPA; Wed, 2 Oct 2024 11:16:02 -0400 (EDT) Received: by vm-mail (OpenSMTPD) with ESMTPSA id dac9d9d8 (TLSv1.3:TLS_AES_256_GCM_SHA384:256:NO); Wed, 2 Oct 2024 15:15:12 +0000 (UTC) Date: Wed, 2 Oct 2024 17:16:00 +0200 From: Patrick Steinhardt To: git@vger.kernel.org Cc: Eli Schwartz Subject: [RFC PATCH 08/21] builtin/credential-cache: fix missing parameter for stub function Message-ID: <7a36ad58384df4d3b0335ffb0c4b63b3e89ccdfb.1727881164.git.ps@pks.im> References: Precedence: bulk X-Mailing-List: git@vger.kernel.org List-Id: List-Subscribe: List-Unsubscribe: MIME-Version: 1.0 Content-Disposition: inline In-Reply-To: When not compiling the credential cache we may use a stub function for `cmd_credential_cache()`. With commit 9b1cb5070f (builtin: add a repository parameter for builtin functions, 2024-09-13), we have added a new parameter to all of those top-level `cmd_*()` functions, and did indeed adapt the non-stubbed-out `cmd_credential_cache()`. But we didn't adapt the stubbed-out variant, so the code does not compile. Fix this by adding the missing parameter. Signed-off-by: Patrick Steinhardt --- builtin/credential-cache.c | 3 ++- 1 file changed, 2 insertions(+), 1 deletion(-) diff --git a/builtin/credential-cache.c b/builtin/credential-cache.c index 5de8b9123b..c51f7fc2ad 100644 --- a/builtin/credential-cache.c +++ b/builtin/credential-cache.c @@ -189,7 +189,8 @@ int cmd_credential_cache(int argc, #else -int cmd_credential_cache(int argc, const char **argv, const char *prefix) +int cmd_credential_cache(int argc, const char **argv, const char *prefix, + struct repository *repo UNUSED) { const char * const usage[] = { "git credential-cache [options] ", From patchwork Wed Oct 2 15:16:02 2024 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: Patrick Steinhardt X-Patchwork-Id: 13819938 Received: from fhigh-a1-smtp.messagingengine.com (fhigh-a1-smtp.messagingengine.com [103.168.172.152]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by smtp.subspace.kernel.org (Postfix) with ESMTPS id 3C6AA1D1304 for ; Wed, 2 Oct 2024 15:16:06 +0000 (UTC) Authentication-Results: smtp.subspace.kernel.org; arc=none smtp.client-ip=103.168.172.152 ARC-Seal: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1727882167; cv=none; b=XR82/xTLXf4ycYYgiDZnP1OxdwzdHCJBsiy31zEYa4LsyND5pr4D8fu3haPqzVY8OI1Ukgxc/onVRrzkWBAJKVJFuGqOZxdU6RKLVyi9BytNSv66wnBdFBN1E5g892ytx96eHTMzMGGhdJI9bUTfflEXWhmPZ2+hsdiiFQArUqg= ARC-Message-Signature: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1727882167; c=relaxed/simple; bh=KaeamRs6hoXQtKAKfTvQNV7Y2Q2d0QKohiI0efm7vDw=; h=Date:From:To:Cc:Subject:Message-ID:References:MIME-Version: Content-Type:Content-Disposition:In-Reply-To; b=suj3ZxPeM1q0lMYGThAhedzTh5CrgIETEzpBkBir6GaHwfJkVnMyAKWMgkhtUYk5dwiFUUuGf7YYC+WsceId2DaKMvUaifsKXhjipGeWRU7ecYj0rPlaE4kdJSjpa/lMYKrRJva/w8e2H1+ASLja7tqdrlK9MzSwhy/2W52Y0VI= ARC-Authentication-Results: i=1; smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=pks.im; spf=pass smtp.mailfrom=pks.im; dkim=pass (2048-bit key) header.d=pks.im header.i=@pks.im header.b=Kdsz3R0a; dkim=pass (2048-bit key) header.d=messagingengine.com header.i=@messagingengine.com header.b=ibp8gCs3; arc=none smtp.client-ip=103.168.172.152 Authentication-Results: smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=pks.im Authentication-Results: smtp.subspace.kernel.org; spf=pass smtp.mailfrom=pks.im Authentication-Results: smtp.subspace.kernel.org; dkim=pass (2048-bit key) header.d=pks.im header.i=@pks.im header.b="Kdsz3R0a"; dkim=pass (2048-bit key) header.d=messagingengine.com header.i=@messagingengine.com header.b="ibp8gCs3" Received: from phl-compute-10.internal (phl-compute-10.phl.internal [10.202.2.50]) by mailfhigh.phl.internal (Postfix) with ESMTP id 948721140111; Wed, 2 Oct 2024 11:16:05 -0400 (EDT) Received: from phl-mailfrontend-02 ([10.202.2.163]) by phl-compute-10.internal (MEProxy); Wed, 02 Oct 2024 11:16:05 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=pks.im; h=cc:cc :content-type:content-type:date:date:from:from:in-reply-to :in-reply-to:message-id:mime-version:references:reply-to:subject :subject:to:to; s=fm2; t=1727882165; x=1727968565; bh=tDRW2ASynI exwAQfMUojWS5wUXxv/OGy14h9d0CTvB0=; b=Kdsz3R0abepYLogyF1hxjPwEN7 jruer0K4UGW9zEz0KjE0QdM3QW6sBizBO1BfyDJak3FjKUKnjSQsH2eLUj6HQEPx f70pK4DJqHObbcVs5/2JXmyWkbt+EzhlWV3RymSJBSlnY8+Voj5MUEojHaBoP8dq Y1kgOba3uHx1Bw3KwrlObVBgeCFN3RZsiiv38t+alXbYwtYei6hqcq3ppfE2IZt/ IO7BG4tba+KzpHZ53gChNLzWFI/Ko3THwfTTq678vpQcUP3BaQyGe7pNnsmkAJSS aXdNRvy2u1CKrjAFmnpm4xEq60dP0dKTaYwUH05SxUGpGXBbmUfYviGX2/jg== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:cc:content-type:content-type:date:date :feedback-id:feedback-id:from:from:in-reply-to:in-reply-to :message-id:mime-version:references:reply-to:subject:subject:to :to:x-me-proxy:x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s= fm2; t=1727882165; x=1727968565; bh=tDRW2ASynIexwAQfMUojWS5wUXxv /OGy14h9d0CTvB0=; b=ibp8gCs31QdNlVtK3jya1xPzt17dJy+Cn6x2T5EYCY+R REt+fJigLlVLx6TA+c56L7XRNJwr3EorHdQ22SPfoyVlOJT/Mge3OkaJCPN9ETUU XYBmFOnVHw3sho9QrqFD4VSskOo9PodOr/qmCQdd/+rRZzLyz0IRgTJCYGlmKJSm zKmAzYZjHFsdUJbhFq/liwysVOOkztxReDfzKQFZxAxUfmSS5fkh2E4IOnfh85F6 NjxRyVsBudr2XgGh6DZyUFARw1Ei2BUZb97d/pCjdTia8CflnzBN1CJ8s7bAC8Uu 5Hbf8ZIEFhj6tG/TRht6c2k+zFRlawQwRLXgT+VLDA== X-ME-Sender: X-ME-Received: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeeftddrvdduledgkeefucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfu rfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucesvcftvggtihhpihgvnh htshculddquddttddmnecujfgurhepfffhvfevuffkfhggtggujgesthdtredttddtvden ucfhrhhomheprfgrthhrihgtkhcuufhtvghinhhhrghrughtuceophhssehpkhhsrdhimh eqnecuggftrfgrthhtvghrnhepveekkeffhfeitdeludeigfejtdetvdelvdduhefgueeg udfghfeukefhjedvkedtnecuvehluhhsthgvrhfuihiivgepfeenucfrrghrrghmpehmrg hilhhfrhhomhepphhssehpkhhsrdhimhdpnhgspghrtghpthhtohepvddpmhhouggvpehs mhhtphhouhhtpdhrtghpthhtohepghhithesvhhgvghrrdhkvghrnhgvlhdrohhrghdprh gtphhtthhopegvshgthhifrghrthiisehgvghnthhoohdrohhrgh X-ME-Proxy: Feedback-ID: i197146af:Fastmail Received: by mail.messagingengine.com (Postfix) with ESMTPA; Wed, 2 Oct 2024 11:16:04 -0400 (EDT) Received: by vm-mail (OpenSMTPD) with ESMTPSA id e2734ac3 (TLSv1.3:TLS_AES_256_GCM_SHA384:256:NO); Wed, 2 Oct 2024 15:15:14 +0000 (UTC) Date: Wed, 2 Oct 2024 17:16:02 +0200 From: Patrick Steinhardt To: git@vger.kernel.org Cc: Eli Schwartz Subject: [RFC PATCH 09/21] http: fix build error on FreeBSD Message-ID: <1c1cd4d8ef9aef843f8825321a2ab7a8026b0580.1727881164.git.ps@pks.im> References: Precedence: bulk X-Mailing-List: git@vger.kernel.org List-Id: List-Subscribe: List-Unsubscribe: MIME-Version: 1.0 Content-Disposition: inline In-Reply-To: The `result` parameter passed to `http_request_reauth()` may either point to a `struct strbuf` or a `FILE *`, where the `target` parameter tells us which of either it actually is. To accommodate for both types the pointer is a `void *`, which we then pass directly to functions without doing a cast. This is fine on most platforms, but it breaks on FreeBSD because `fileno()` is implemented as a macro that tries to directly access the `FILE *` structure. Fix this issue by storing the `FILE *` in a local variable before we pass it on to other functions. Signed-off-by: Patrick Steinhardt --- http.c | 10 ++++++---- 1 file changed, 6 insertions(+), 4 deletions(-) diff --git a/http.c b/http.c index 376af88c5d..28f70a7a9c 100644 --- a/http.c +++ b/http.c @@ -2289,17 +2289,19 @@ static int http_request_reauth(const char *url, case HTTP_REQUEST_STRBUF: strbuf_reset(result); break; - case HTTP_REQUEST_FILE: - if (fflush(result)) { + case HTTP_REQUEST_FILE: { + FILE *f = result; + if (fflush(f)) { error_errno("unable to flush a file"); return HTTP_START_FAILED; } - rewind(result); - if (ftruncate(fileno(result), 0) < 0) { + rewind(f); + if (ftruncate(fileno(f), 0) < 0) { error_errno("unable to truncate a file"); return HTTP_START_FAILED; } break; + } default: BUG("Unknown http_request target"); } From patchwork Wed Oct 2 15:16:05 2024 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: Patrick Steinhardt X-Patchwork-Id: 13819939 Received: from fout-a3-smtp.messagingengine.com (fout-a3-smtp.messagingengine.com [103.168.172.146]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by smtp.subspace.kernel.org (Postfix) with ESMTPS id 44C2F1D0DD9 for ; Wed, 2 Oct 2024 15:16:09 +0000 (UTC) Authentication-Results: smtp.subspace.kernel.org; arc=none smtp.client-ip=103.168.172.146 ARC-Seal: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1727882170; cv=none; b=ENvRCaUX4lA7RVMmmXdzgCbV8+o9pq4gi6ZzGqRlAr20yBIRUSBZ63o7MuaCVeY04GV0hYpJ9c/VWJ/lj2JQh0+2rk4YvdFZoCwLbTV8/3oSK6+kVZrN/3TB5tpFtoSOYFdZwFYUtxXtkFQMBs319S4uczN6pr+IUxoYfwdcvEA= ARC-Message-Signature: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1727882170; c=relaxed/simple; bh=OrHKwcb4/ayllhi/mpJ0wA1bUBK5+RMD5t2MnfDuuCE=; h=Date:From:To:Cc:Subject:Message-ID:References:MIME-Version: Content-Type:Content-Disposition:In-Reply-To; b=cPS47dh+nCi9eLrULCNxJ5dFXHhPsIenAfLKLKLIZlDqEIgc0ODfqVV06McdEE9OjZfLzgtrypyWBfeKpJz5HXNWIsqZXWW4Qu8vCpTTUWj9XbgTohhsQDEpvwtDdw2Zsj/rkQxOJZKhWp1xzF1kY7kIlfcNzUUNPxVp4WL64i4= ARC-Authentication-Results: i=1; smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=pks.im; spf=pass smtp.mailfrom=pks.im; dkim=pass (2048-bit key) header.d=pks.im header.i=@pks.im header.b=PaiM9pWF; dkim=pass (2048-bit key) header.d=messagingengine.com header.i=@messagingengine.com header.b=C/v6jdX+; arc=none smtp.client-ip=103.168.172.146 Authentication-Results: smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=pks.im Authentication-Results: smtp.subspace.kernel.org; spf=pass smtp.mailfrom=pks.im Authentication-Results: smtp.subspace.kernel.org; dkim=pass (2048-bit key) header.d=pks.im header.i=@pks.im header.b="PaiM9pWF"; dkim=pass (2048-bit key) header.d=messagingengine.com header.i=@messagingengine.com header.b="C/v6jdX+" Received: from phl-compute-01.internal (phl-compute-01.phl.internal [10.202.2.41]) by mailfout.phl.internal (Postfix) with ESMTP id 9047D1380250; Wed, 2 Oct 2024 11:16:08 -0400 (EDT) Received: from phl-mailfrontend-02 ([10.202.2.163]) by phl-compute-01.internal (MEProxy); Wed, 02 Oct 2024 11:16:08 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=pks.im; h=cc:cc :content-type:content-type:date:date:from:from:in-reply-to :in-reply-to:message-id:mime-version:references:reply-to:subject :subject:to:to; s=fm2; t=1727882168; x=1727968568; bh=cL2nu93qkw Y/QAK1BC9dXkiX+7l+O4wq8LdwUc4F0DA=; b=PaiM9pWFrawiRXry0GKdjDO3lU O4LXxZp2ZqSdqhj4ENKzbzM/i6/ICyiekaaX/JSfsbUPrmWgLghb4CJudXYWXeQA XMNZ+GpJk4iD8ghK1aTBkBi2SxCYZqL9pISs50A11z74BoBeaP1jtfIS0Uo8APMS b9UVKQWp4TUS15lZAjarmez42N0aGR/kvssriLbACue50MTkB/0MKsmGBiH+BeDv NIIyBkwV++lxsIXbj2h1oFN6l0BFyTquBIAlMsE6OFxe7PzgRfP6MhfmFIHvbLv+ jYBSh0Htx9/RlxrpgcrFZ6leuU4zXtdyK/SgQqjMBzrGlP+nqzv3egrJ7VIQ== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:cc:content-type:content-type:date:date :feedback-id:feedback-id:from:from:in-reply-to:in-reply-to :message-id:mime-version:references:reply-to:subject:subject:to :to:x-me-proxy:x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s= fm2; t=1727882168; x=1727968568; bh=cL2nu93qkwY/QAK1BC9dXkiX+7l+ O4wq8LdwUc4F0DA=; b=C/v6jdX+ze4ilXcf2/p8e0ArOkXyDD8EFfMBfqtsZ3Mf n7SzlsgDfcKPuf+MCmmj5IoMc+FquD7+7ELX8IbZMf2rZcuJ2ErO/FrJUShSm4B/ vf4TZKKqrxG+QsrE3x0R79oC5RMcXJ7O8jOzRudi/YDsbdwmR63Di1OJAgnSvsO6 GreENw+NZIz21O8OYG9F8AqgdKUNRqVkJaI6O/k4rP5KTjPbZ39OsB0WehF9D8Va OgGUaoxhheI7cLmwTtqeePHDNKihmJG3gZVIAZ1guHETHEELeVZqeehTpuMP1zM1 w5nccsGQhneJLKO9rtglwh2Nt2LiEyT9F5XvvO07Rw== X-ME-Sender: X-ME-Received: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeeftddrvdduledgkeefucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfu rfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucesvcftvggtihhpihgvnh htshculddquddttddmnecujfgurhepfffhvfevuffkfhggtggujgesthdtredttddtvden ucfhrhhomheprfgrthhrihgtkhcuufhtvghinhhhrghrughtuceophhssehpkhhsrdhimh eqnecuggftrfgrthhtvghrnhepveekkeffhfeitdeludeigfejtdetvdelvdduhefgueeg udfghfeukefhjedvkedtnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehmrg hilhhfrhhomhepphhssehpkhhsrdhimhdpnhgspghrtghpthhtohepvddpmhhouggvpehs mhhtphhouhhtpdhrtghpthhtohepghhithesvhhgvghrrdhkvghrnhgvlhdrohhrghdprh gtphhtthhopegvshgthhifrghrthiisehgvghnthhoohdrohhrgh X-ME-Proxy: Feedback-ID: i197146af:Fastmail Received: by mail.messagingengine.com (Postfix) with ESMTPA; Wed, 2 Oct 2024 11:16:07 -0400 (EDT) Received: by vm-mail (OpenSMTPD) with ESMTPSA id c131ddac (TLSv1.3:TLS_AES_256_GCM_SHA384:256:NO); Wed, 2 Oct 2024 15:15:17 +0000 (UTC) Date: Wed, 2 Oct 2024 17:16:05 +0200 From: Patrick Steinhardt To: git@vger.kernel.org Cc: Eli Schwartz Subject: [RFC PATCH 10/21] Makefile: extract script to generate clar declarations Message-ID: References: Precedence: bulk X-Mailing-List: git@vger.kernel.org List-Id: List-Subscribe: List-Unsubscribe: MIME-Version: 1.0 Content-Disposition: inline In-Reply-To: Extract the script to generate function declarations for the clar unit testing framework into a standalone script. This is done such that we can reuse it in other build systems. Signed-off-by: Patrick Steinhardt --- Makefile | 4 +--- t/unit-tests/generate-clar-decls.sh | 16 ++++++++++++++++ 2 files changed, 17 insertions(+), 3 deletions(-) create mode 100755 t/unit-tests/generate-clar-decls.sh diff --git a/Makefile b/Makefile index 7344a7f725..de6426a684 100644 --- a/Makefile +++ b/Makefile @@ -3880,9 +3880,7 @@ GIT-TEST-SUITES: FORCE fi $(UNIT_TEST_DIR)/clar-decls.h: $(patsubst %,$(UNIT_TEST_DIR)/%.c,$(CLAR_TEST_SUITES)) GIT-TEST-SUITES - $(QUIET_GEN)for suite in $(CLAR_TEST_SUITES); do \ - sed -ne "s/^\(void test_$${suite}__[a-zA-Z_0-9][a-zA-Z_0-9]*(void)$$\)/extern \1;/p" $(UNIT_TEST_DIR)/$$suite.c; \ - done >$@ + $(QUIET_GEN)$(SHELL_PATH) $(UNIT_TEST_DIR)/generate-clar-decls.sh "$@" $(patsubst %,$(UNIT_TEST_DIR)/%.c,$(CLAR_TEST_SUITES)) $(UNIT_TEST_DIR)/clar.suite: $(UNIT_TEST_DIR)/clar-decls.h $(QUIET_GEN)awk -f $(UNIT_TEST_DIR)/clar-generate.awk $< >$(UNIT_TEST_DIR)/clar.suite $(CLAR_TEST_OBJS): $(UNIT_TEST_DIR)/clar-decls.h diff --git a/t/unit-tests/generate-clar-decls.sh b/t/unit-tests/generate-clar-decls.sh new file mode 100755 index 0000000000..d5ddbaa5da --- /dev/null +++ b/t/unit-tests/generate-clar-decls.sh @@ -0,0 +1,16 @@ +#!/bin/sh + +if test $# -lt 3 +then + echo "USAGE: $0 ..." 2>&1 + exit 1 +fi + +OUTPUT="$1" +shift + +for suite in $* +do + sed -ne "s/^\(void test_$suite__[a-zA-Z_0-9][a-zA-Z_0-9]*(void)$\)/extern \1;/p" "$suite" || + exit 1 +done >"$OUTPUT" From patchwork Wed Oct 2 15:16:08 2024 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: Patrick Steinhardt X-Patchwork-Id: 13819940 Received: from fhigh-a1-smtp.messagingengine.com (fhigh-a1-smtp.messagingengine.com [103.168.172.152]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by smtp.subspace.kernel.org (Postfix) with ESMTPS id 6EFDB1D14EA for ; Wed, 2 Oct 2024 15:16:12 +0000 (UTC) Authentication-Results: smtp.subspace.kernel.org; arc=none smtp.client-ip=103.168.172.152 ARC-Seal: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1727882174; cv=none; b=dQtRBQbazU4UhBzfWzaDEEnCbUFaBxhnrauzuYcX2ITDS14xXhFMHzg7+InQvttV+e/djquRWlbRipDEhp7GBxrJK/zpv/x2JfQEsv9pXJRUSo5Ln7jWQlPy42j7StPlR/7TgIl9iL/4fAQqkauOuyHlm5TA5S1kdPWLTynDIQM= ARC-Message-Signature: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1727882174; c=relaxed/simple; bh=ZHikQOgNCMLy9BqMi9xwV6zKQ/P9jM9unmrS2+4ws0I=; h=Date:From:To:Cc:Subject:Message-ID:References:MIME-Version: Content-Type:Content-Disposition:In-Reply-To; b=o8+JRcm0JeQN2eh7suPE4y8bk+JK2BSDgbdpdRIknkezva9qlIgBDI6p3WSNVlFvUel4j7CjSYgc+H7Vzq5ydrStYvlGx+XGGYNaANIMNtlLPedt3IGd6UeGz3V8kOch2LBKHjdVjcx8Ei07s93hMNgdrvApaEIbG3b2xVEadgk= ARC-Authentication-Results: i=1; smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=pks.im; spf=pass smtp.mailfrom=pks.im; dkim=pass (2048-bit key) header.d=pks.im header.i=@pks.im header.b=AbRZGEW8; dkim=pass (2048-bit key) header.d=messagingengine.com header.i=@messagingengine.com header.b=YNs4fKCV; arc=none smtp.client-ip=103.168.172.152 Authentication-Results: smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=pks.im Authentication-Results: smtp.subspace.kernel.org; spf=pass smtp.mailfrom=pks.im Authentication-Results: smtp.subspace.kernel.org; dkim=pass (2048-bit key) header.d=pks.im header.i=@pks.im header.b="AbRZGEW8"; dkim=pass (2048-bit key) header.d=messagingengine.com header.i=@messagingengine.com header.b="YNs4fKCV" Received: from phl-compute-08.internal (phl-compute-08.phl.internal [10.202.2.48]) by mailfhigh.phl.internal (Postfix) with ESMTP id A5CC91140109; Wed, 2 Oct 2024 11:16:11 -0400 (EDT) Received: from phl-mailfrontend-02 ([10.202.2.163]) by phl-compute-08.internal (MEProxy); Wed, 02 Oct 2024 11:16:11 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=pks.im; h=cc:cc :content-type:content-type:date:date:from:from:in-reply-to :in-reply-to:message-id:mime-version:references:reply-to:subject :subject:to:to; s=fm2; t=1727882171; x=1727968571; bh=XgZAUMGLQE USrjffpURbdvHtxQmHZwfZl22PufOVwD4=; b=AbRZGEW83Dw0S3j0G0fRH7hoTO 08i81wFilS5T/PHfMFWsHQneWrIzaamah2pHQWrFlfBrF5CH4JOKxNwdLj/5RpxW 7nkolfbPUM7xTO6qg/JvqQevh49GkwnRy1YsrcUDQnzsCdU453q9tMHk7cVXOUkB 3JUQnyT64Tmnaz/ho0uNXT+4AMGpCTNZf4enR7jCcnGzJKxa1UF7wh8XKwLYVNf0 VQS+H3jjY6TWyf1amK76B/BeyakmGXzlQ27/8IqbajX/mMnbEKlMVAsJ+kq9y6nz d+Bhy4630sQwtEih0p9CEDAVgfuwTO7Vy4YNvEezt1wpAMf0Fd55IOeOtg0g== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:cc:content-type:content-type:date:date :feedback-id:feedback-id:from:from:in-reply-to:in-reply-to :message-id:mime-version:references:reply-to:subject:subject:to :to:x-me-proxy:x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s= fm2; t=1727882171; x=1727968571; bh=XgZAUMGLQEUSrjffpURbdvHtxQmH ZwfZl22PufOVwD4=; b=YNs4fKCVFW7rFHlR45q1X3xIoL53zGLsK4tLyz8ImWP4 crxKvXBsJNo0IsDIAEbwQ3WNifPPZBDpfoNYE+RA4SMy6eQDGwEsrwBH2cmVWmkR JlokpP0hOSczn8PSPtvFojIMSwZSedZ0DqUWFerzePPBys5U3nAcUJJnfvUZTLQT I6xRDPr+G7pMYTvDQP5XeE3++wa3p9VGY0GFTOQLGVYdeksdSq7Rxz07g+3tuCjY W7a5Ykt+fT/mTSyLizDObB74Rmm5xdoMn4Qntp47LNfWjH31isx4cOpBlF94N+X+ DuYMx0J1qqX4VH0L5ozlRxxHOJmAXY1FdcJm5kcTlQ== X-ME-Sender: X-ME-Received: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeeftddrvdduledgkedvucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfu rfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucesvcftvggtihhpihgvnh htshculddquddttddmnecujfgurhepfffhvfevuffkfhggtggujgesthdtredttddtvden ucfhrhhomheprfgrthhrihgtkhcuufhtvghinhhhrghrughtuceophhssehpkhhsrdhimh eqnecuggftrfgrthhtvghrnhepveekkeffhfeitdeludeigfejtdetvdelvdduhefgueeg udfghfeukefhjedvkedtnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehmrg hilhhfrhhomhepphhssehpkhhsrdhimhdpnhgspghrtghpthhtohepvddpmhhouggvpehs mhhtphhouhhtpdhrtghpthhtohepvghstghhfigrrhhtiiesghgvnhhtohhordhorhhgpd hrtghpthhtohepghhithesvhhgvghrrdhkvghrnhgvlhdrohhrgh X-ME-Proxy: Feedback-ID: i197146af:Fastmail Received: by mail.messagingengine.com (Postfix) with ESMTPA; Wed, 2 Oct 2024 11:16:10 -0400 (EDT) Received: by vm-mail (OpenSMTPD) with ESMTPSA id a50febc5 (TLSv1.3:TLS_AES_256_GCM_SHA384:256:NO); Wed, 2 Oct 2024 15:15:20 +0000 (UTC) Date: Wed, 2 Oct 2024 17:16:08 +0200 From: Patrick Steinhardt To: git@vger.kernel.org Cc: Eli Schwartz Subject: [RFC PATCH 11/21] Makefile: extract script to massage Perl scripts Message-ID: References: Precedence: bulk X-Mailing-List: git@vger.kernel.org List-Id: List-Subscribe: List-Unsubscribe: MIME-Version: 1.0 Content-Disposition: inline In-Reply-To: Extract the script to inject various build-time parameters into our Perl scripts into a standalone script. This is done such that we can reuse it in other build systems. Signed-off-by: Patrick Steinhardt --- Makefile | 10 +--------- generate-perl.sh | 22 ++++++++++++++++++++++ 2 files changed, 23 insertions(+), 9 deletions(-) create mode 100755 generate-perl.sh diff --git a/Makefile b/Makefile index de6426a684..f582ccdc98 100644 --- a/Makefile +++ b/Makefile @@ -2580,15 +2580,7 @@ endif PERL_DEFINES += $(gitexecdir) $(perllibdir) $(localedir) $(SCRIPT_PERL_GEN): % : %.perl GIT-PERL-DEFINES GIT-PERL-HEADER GIT-VERSION-FILE - $(QUIET_GEN) \ - sed -e '1{' \ - -e ' s|#!.*perl|#!$(PERL_PATH_SQ)|' \ - -e ' r GIT-PERL-HEADER' \ - -e ' G' \ - -e '}' \ - -e 's/@@GIT_VERSION@@/$(GIT_VERSION)/g' \ - $< >$@+ && \ - chmod +x $@+ && \ + $(QUIET_GEN)$(SHELL_PATH) generate-perl.sh $(GIT_VERSION) GIT-PERL-HEADER "$(PERL_PATH_SQ)" "$<" "$@+" && \ mv $@+ $@ PERL_DEFINES := $(subst $(space),:,$(PERL_DEFINES)) diff --git a/generate-perl.sh b/generate-perl.sh new file mode 100755 index 0000000000..b9e04d6f42 --- /dev/null +++ b/generate-perl.sh @@ -0,0 +1,22 @@ +#!/bin/sh + +if test $# -ne 5 +then + echo "USAGE: $0 " >&2 + exit 1 +fi + +GIT_VERSION="$1" +PERL_HEADER="$2" +PERL_PATH="$3" +PERL_SCRIPT="$4" +OUT="$5" + +sed -e '1{' \ + -e " s|#!.*perl|#!$PERL_PATH|" \ + -e " r $PERL_HEADER" \ + -e ' G' \ + -e '}' \ + -e "s/@@GIT_VERSION@@/$GIT_VERSION/g" \ + "$PERL_SCRIPT" >"$OUT" +chmod a+x "$OUT" From patchwork Wed Oct 2 15:16:11 2024 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: Patrick Steinhardt X-Patchwork-Id: 13819941 Received: from fout-a3-smtp.messagingengine.com (fout-a3-smtp.messagingengine.com [103.168.172.146]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by smtp.subspace.kernel.org (Postfix) with ESMTPS id 842231D0BAA for ; Wed, 2 Oct 2024 15:16:17 +0000 (UTC) Authentication-Results: smtp.subspace.kernel.org; arc=none smtp.client-ip=103.168.172.146 ARC-Seal: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1727882179; cv=none; b=EEo/j9gKdq4P7N90rpYsmIwXsBxF6mtzYTZAGxg9RugnZLll72yM0KWEzK1vSS9ZEBGj2+xbC4C2f2KI5B02fQSDb5yyFQr0piMdxRDnzDawIP/UmvFwNFOcelx+L0Is9f1m1bXNN+1+kn70WZXdEE4pw2klXAI2VeDoVdxCjFE= ARC-Message-Signature: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1727882179; c=relaxed/simple; bh=m1SV/tgZtrcWTtn/OL9Ai/xju3mRiYFJusg2ukjY978=; h=Date:From:To:Cc:Subject:Message-ID:References:MIME-Version: Content-Type:Content-Disposition:In-Reply-To; b=UwKHPxcGkrCdoWpVp2awvcGOM44d9IM4743Mvet2LXI50FLUBl+0NP7h2BL+7DsCUZVG7X+BJiYkoWJ2q5BSQMGFfu/v3XTcR7nehoh4h6KN4R9VSuKEKQ9R2dl3Aq1qBexyk92iBLQ0uZ8DI/BF0N6Vj3wh1CqqS5tJXHG/mnY= ARC-Authentication-Results: i=1; smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=pks.im; spf=pass smtp.mailfrom=pks.im; dkim=pass (2048-bit key) header.d=pks.im header.i=@pks.im header.b=e2iGrt0L; dkim=pass (2048-bit key) header.d=messagingengine.com header.i=@messagingengine.com header.b=F9Gh1g/w; arc=none smtp.client-ip=103.168.172.146 Authentication-Results: smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=pks.im Authentication-Results: smtp.subspace.kernel.org; spf=pass smtp.mailfrom=pks.im Authentication-Results: smtp.subspace.kernel.org; dkim=pass (2048-bit key) header.d=pks.im header.i=@pks.im header.b="e2iGrt0L"; dkim=pass (2048-bit key) header.d=messagingengine.com header.i=@messagingengine.com header.b="F9Gh1g/w" Received: from phl-compute-12.internal (phl-compute-12.phl.internal [10.202.2.52]) by mailfout.phl.internal (Postfix) with ESMTP id B557013801B1; Wed, 2 Oct 2024 11:16:16 -0400 (EDT) Received: from phl-mailfrontend-02 ([10.202.2.163]) by phl-compute-12.internal (MEProxy); Wed, 02 Oct 2024 11:16:16 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=pks.im; h=cc:cc :content-type:content-type:date:date:from:from:in-reply-to :in-reply-to:message-id:mime-version:references:reply-to:subject :subject:to:to; s=fm2; t=1727882176; x=1727968576; bh=ShOC0RDAt1 Zkm9lhGo59IQ6zHISk7CuyKzDT510He9k=; b=e2iGrt0LNlkJYSoHFgW9ZaVbvY klXOXyXzeD1Db+kmA7d0eLSVgR00YJ4gFr8iBpFyoO1p8fLZl9ee4dwCmGQjeuxt jBmN+06G8YvF3ceW0ERVDk6MMTA+Q0Tl+7R63ztAKFp5ke3jsOvPkU+FVvFo9brT 9YTrgTuyVLFh6OodD55mbcTwx+PVwLzTA/eWQr8ebKUrwkHsynx7jgu8/n0XcbwH bxEO0z77WmDEnLZkqZx1zjSTm47uYR0vCHcO6wl+QgC5mLqkTB3gLcnvVd2qEoPs C+1JpOTKvaz7E6pJVxSqnnMLANB2IDWgbg9r64/PP5D3iCUjMgeSJcSpRIlw== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:cc:content-type:content-type:date:date :feedback-id:feedback-id:from:from:in-reply-to:in-reply-to :message-id:mime-version:references:reply-to:subject:subject:to :to:x-me-proxy:x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s= fm2; t=1727882176; x=1727968576; bh=ShOC0RDAt1Zkm9lhGo59IQ6zHISk 7CuyKzDT510He9k=; b=F9Gh1g/wWyEWfuGsZVynn8rusQqtmC663H8Nl6WSMg3e lDDbte2zvoB6gc7x89QiS53jGGzlYj0B/RAH7rfFum7GmPXcVkdVPLAtvHyMdJee EaOtX8LdIKuwQuVvgMNNCQFM+me/D3tMMEBwxcAevfau3YL7WN9uQw/LPUi6qJ4Z XFU1N+dd+23vPZBrccizJ3DUKdIf02UJI75jJm4HW9EqYgGZvKbIUvAGHodUq43M uxjbHv4JgCBs6pXj2ensVzGhd1glmTFuQRTED52RNz/o3ztm14uGnZiJU3/EyCyl pxr8fAmxZyHdx77DcXbFFzdMLXzq89+VS/fMYkEk2g== X-ME-Sender: X-ME-Received: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeeftddrvdduledgkeefucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfu rfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucesvcftvggtihhpihgvnh htshculddquddttddmnecujfgurhepfffhvfevuffkfhggtggujgesthdtredttddtvden ucfhrhhomheprfgrthhrihgtkhcuufhtvghinhhhrghrughtuceophhssehpkhhsrdhimh eqnecuggftrfgrthhtvghrnhepveekkeffhfeitdeludeigfejtdetvdelvdduhefgueeg udfghfeukefhjedvkedtnecuvehluhhsthgvrhfuihiivgepudenucfrrghrrghmpehmrg hilhhfrhhomhepphhssehpkhhsrdhimhdpnhgspghrtghpthhtohepvddpmhhouggvpehs mhhtphhouhhtpdhrtghpthhtohepvghstghhfigrrhhtiiesghgvnhhtohhordhorhhgpd hrtghpthhtohepghhithesvhhgvghrrdhkvghrnhgvlhdrohhrgh X-ME-Proxy: Feedback-ID: i197146af:Fastmail Received: by mail.messagingengine.com (Postfix) with ESMTPA; Wed, 2 Oct 2024 11:16:15 -0400 (EDT) Received: by vm-mail (OpenSMTPD) with ESMTPSA id 3ae9415c (TLSv1.3:TLS_AES_256_GCM_SHA384:256:NO); Wed, 2 Oct 2024 15:15:25 +0000 (UTC) Date: Wed, 2 Oct 2024 17:16:11 +0200 From: Patrick Steinhardt To: git@vger.kernel.org Cc: Eli Schwartz Subject: [RFC PATCH 12/21] Makefile: refactor GIT-VERSION-GEN to be reusable Message-ID: References: Precedence: bulk X-Mailing-List: git@vger.kernel.org List-Id: List-Subscribe: List-Unsubscribe: MIME-Version: 1.0 Content-Disposition: inline In-Reply-To: Our "GIT-VERSION-GEN" script always writes the "GIT-VERSION-FILE" into the current directory, where the expectation is that it should exist in the source directory. But other build systems that support out-of-tree builds may not want to do that to keep the source directory pristine, even though CMake currently doesn't care. Refactor the script such that it doesn't write output to a file anymore but so that it instead writes the version to stdout. This makes it easier to compute the same version as our Makefile would without having to write the "GIT-VERSION-FILE". We should ideally refactor our CMake build instructions to stop writing into the source directory. But this step is out of scope of the current patch series. Signed-off-by: Patrick Steinhardt --- GIT-VERSION-GEN | 12 +----------- Makefile | 3 ++- contrib/buildsystems/CMakeLists.txt | 5 ++++- 3 files changed, 7 insertions(+), 13 deletions(-) diff --git a/GIT-VERSION-GEN b/GIT-VERSION-GEN index 38e920725c..f626d74d6d 100755 --- a/GIT-VERSION-GEN +++ b/GIT-VERSION-GEN @@ -1,6 +1,5 @@ #!/bin/sh -GVF=GIT-VERSION-FILE DEF_VER=v2.47.0-rc0 LF=' @@ -28,13 +27,4 @@ fi VN=$(expr "$VN" : v*'\(.*\)') -if test -r $GVF -then - VC=$(sed -e 's/^GIT_VERSION = //' <$GVF) -else - VC=unset -fi -test "$VN" = "$VC" || { - echo >&2 "GIT_VERSION = $VN" - echo "GIT_VERSION = $VN" >$GVF -} +echo "$VN" diff --git a/Makefile b/Makefile index f582ccdc98..fae931ff0b 100644 --- a/Makefile +++ b/Makefile @@ -588,7 +588,8 @@ include shared.mak # Disable -pedantic compilation. GIT-VERSION-FILE: FORCE - @$(SHELL_PATH) ./GIT-VERSION-GEN + @printf "GIT_VERSION = %s\n" $$($(SHELL_PATH) GIT-VERSION-GEN) >$@+ + @if cmp $@+ $@ >/dev/null 2>&1; then $(RM) $@+; else cat $@+ >&2 && mv $@+ $@; fi -include GIT-VERSION-FILE # Set our default configuration. diff --git a/contrib/buildsystems/CMakeLists.txt b/contrib/buildsystems/CMakeLists.txt index 62af7b33d2..01a23788e1 100644 --- a/contrib/buildsystems/CMakeLists.txt +++ b/contrib/buildsystems/CMakeLists.txt @@ -87,7 +87,10 @@ endif() if(NOT EXISTS ${CMAKE_SOURCE_DIR}/GIT-VERSION-FILE) message("Generating GIT-VERSION-FILE") execute_process(COMMAND ${SH_EXE} ${CMAKE_SOURCE_DIR}/GIT-VERSION-GEN - WORKING_DIRECTORY ${CMAKE_SOURCE_DIR}) + WORKING_DIRECTORY ${CMAKE_SOURCE_DIR} + OUTPUT_VARIABLE GIT_VERSION + OUTPUT_STRIP_TRAILING_WHITESPACE) + file(WRITE ${CMAKE_BINARY_DIR}/GIT-BUILD-OPTIONS "GIT_VERSION = '${GIT_VERSION}'\n") endif() #Parse GIT-VERSION-FILE to get the version From patchwork Wed Oct 2 15:16:18 2024 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: Patrick Steinhardt X-Patchwork-Id: 13819942 Received: from fout-a3-smtp.messagingengine.com (fout-a3-smtp.messagingengine.com [103.168.172.146]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by smtp.subspace.kernel.org (Postfix) with ESMTPS id A628D1D0DE9 for ; Wed, 2 Oct 2024 15:16:22 +0000 (UTC) Authentication-Results: smtp.subspace.kernel.org; arc=none smtp.client-ip=103.168.172.146 ARC-Seal: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1727882184; cv=none; b=UfpS8NhC+2qH/BFFgla39M8kv0Q4yvEmkvB61cy0FKJVeEXuhAzaTFF4N3jtICXWGVN/9HMJ2AKs2c+lC7Ck/cPAEsN6UlKw8oTY7g+w+tCoMZJjQzCzVvTh1dkz+bCP0uJangT26Fb+uB3AQyX9Hnnr5y2zeRcS+RMxKIjl5sg= ARC-Message-Signature: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1727882184; c=relaxed/simple; bh=BBs4gnf0HNX17eHsXq7JQ3P5bvbJK3cDcO0NDvoGzhs=; h=Date:From:To:Cc:Subject:Message-ID:References:MIME-Version: Content-Type:Content-Disposition:In-Reply-To; b=sbBDLPa5G1r9swEE7cgxA834SgK5nbVw2mrsxqk/KtNdHaT1f/Ca8KccVtLP48hwHNpQZ//dty9895MtMpedFzvVSSQTAq7+0yT5vg7K7JBYw1usDdqyKA1+Vy/5XpICtndGR5th3SoTOvVrGklJVCGoApV+sSFk6/3jnQlyXBs= ARC-Authentication-Results: i=1; smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=pks.im; spf=pass smtp.mailfrom=pks.im; dkim=pass (2048-bit key) header.d=pks.im header.i=@pks.im header.b=CU7Od2eL; dkim=pass (2048-bit key) header.d=messagingengine.com header.i=@messagingengine.com header.b=WGrG0kBH; arc=none smtp.client-ip=103.168.172.146 Authentication-Results: smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=pks.im Authentication-Results: smtp.subspace.kernel.org; spf=pass smtp.mailfrom=pks.im Authentication-Results: smtp.subspace.kernel.org; dkim=pass (2048-bit key) header.d=pks.im header.i=@pks.im header.b="CU7Od2eL"; dkim=pass (2048-bit key) header.d=messagingengine.com header.i=@messagingengine.com header.b="WGrG0kBH" Received: from phl-compute-09.internal (phl-compute-09.phl.internal [10.202.2.49]) by mailfout.phl.internal (Postfix) with ESMTP id C635D13801B1; Wed, 2 Oct 2024 11:16:21 -0400 (EDT) Received: from phl-mailfrontend-02 ([10.202.2.163]) by phl-compute-09.internal (MEProxy); Wed, 02 Oct 2024 11:16:21 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=pks.im; h=cc:cc :content-type:content-type:date:date:from:from:in-reply-to :in-reply-to:message-id:mime-version:references:reply-to:subject :subject:to:to; s=fm2; t=1727882181; x=1727968581; bh=Zz/nGvoah/ UnRs1bCgYhrmEhmjpZOb2Jyoej8ZlELFM=; b=CU7Od2eL8op6+oakvxji5vgwZB aNoJuOhBvv422dRJ0TXmJuQYjGndygl07fq/HD9VOVLf61//7CxsaQYh+UTywvGf V9V5bX/hwGLPR+MEqwAqDMZ1ej5v/A27aTrcih3nnIUxAiIe5wiO+EutcPOa0NQz 3YUrGQa0qr+us7xasb9AQDKxTOqdCAatMpa8yOYHmWFTjrvp0yW8f8WXY/TIJorg a24TOvRB9J0qusDjFb6hBt9Z5eZAWOGTZWOrt25EVKEPFRvtVCqZpP5PXH9rtaym it6NUJgE6c2p/emMpIyQ0LPMn8fEP+8Zw+l+uDKDhy8iENBtmUJvHR+8FwfQ== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:cc:content-type:content-type:date:date :feedback-id:feedback-id:from:from:in-reply-to:in-reply-to :message-id:mime-version:references:reply-to:subject:subject:to :to:x-me-proxy:x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s= fm2; t=1727882181; x=1727968581; bh=Zz/nGvoah/UnRs1bCgYhrmEhmjpZ Ob2Jyoej8ZlELFM=; b=WGrG0kBHiGbNol253uj4EYItp1Bjg+m6DYSnDPtDS+pc OIMnDeNtfh5k3hVJGWleGAsD88sKZIB4792x+9OU8lO6vZ441cEexrVqSyNka/uh JBlwYtQNMn0C0gIvprtPTVl5VZvaALx+a1V0wLpY4fyyc17B2XYyQMgorjDhqYz+ tgy87hzqQPEGq5ME/OkSoyJzS4lsxOHv0S0M4QX08HEtagbAoEnuIsAueDo3r8OC ymVpWQVZ3nXa9TV/UiNct4ZqrHbs0mTfPBvHZ3IC0ROXbtgzeRQNMd5XmHK/B2Ik 9IDOgBWqSKPZ6hm+pr4Vt9wPt7+gKfS9ROtVlWMdiA== X-ME-Sender: X-ME-Received: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeeftddrvdduledgkeefucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfu rfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucesvcftvggtihhpihgvnh htshculddquddttddmnecujfgurhepfffhvfevuffkfhggtggujgesthdtredttddtvden ucfhrhhomheprfgrthhrihgtkhcuufhtvghinhhhrghrughtuceophhssehpkhhsrdhimh eqnecuggftrfgrthhtvghrnhepveekkeffhfeitdeludeigfejtdetvdelvdduhefgueeg udfghfeukefhjedvkedtnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehmrg hilhhfrhhomhepphhssehpkhhsrdhimhdpnhgspghrtghpthhtohepvddpmhhouggvpehs mhhtphhouhhtpdhrtghpthhtohepvghstghhfigrrhhtiiesghgvnhhtohhordhorhhgpd hrtghpthhtohepghhithesvhhgvghrrdhkvghrnhgvlhdrohhrgh X-ME-Proxy: Feedback-ID: i197146af:Fastmail Received: by mail.messagingengine.com (Postfix) with ESMTPA; Wed, 2 Oct 2024 11:16:20 -0400 (EDT) Received: by vm-mail (OpenSMTPD) with ESMTPSA id 397dc525 (TLSv1.3:TLS_AES_256_GCM_SHA384:256:NO); Wed, 2 Oct 2024 15:15:30 +0000 (UTC) Date: Wed, 2 Oct 2024 17:16:18 +0200 From: Patrick Steinhardt To: git@vger.kernel.org Cc: Eli Schwartz Subject: [RFC PATCH 13/21] Makefile: refactor generators to be PWD-independent Message-ID: <7136aeaa1388cfc431948df7783abe051df5e60e.1727881164.git.ps@pks.im> References: Precedence: bulk X-Mailing-List: git@vger.kernel.org List-Id: List-Subscribe: List-Unsubscribe: MIME-Version: 1.0 Content-Disposition: inline In-Reply-To: We have multiple scripts that generate headers from other data. All of these scripts have the assumption built-in that they are executed in the current source directory, which makes them a bit unwieldy to use during out-of-tree builds. This makes them a bit unwieldy to use. Refactor them to instead take the source directory as well as the output file as arguments. Signed-off-by: Patrick Steinhardt --- Makefile | 6 ++--- contrib/buildsystems/CMakeLists.txt | 12 +++------ generate-cmdlist.sh | 42 ++++++++++++++++++----------- generate-configlist.sh | 20 ++++++++++---- generate-hooklist.sh | 15 ++++++++++- 5 files changed, 61 insertions(+), 34 deletions(-) diff --git a/Makefile b/Makefile index fae931ff0b..d128b5b3e4 100644 --- a/Makefile +++ b/Makefile @@ -2498,17 +2498,17 @@ $(BUILT_INS): git$X config-list.h: generate-configlist.sh config-list.h: Documentation/*config.txt Documentation/config/*.txt - $(QUIET_GEN)$(SHELL_PATH) ./generate-configlist.sh >$@ + $(QUIET_GEN)$(SHELL_PATH) ./generate-configlist.sh . $@ command-list.h: generate-cmdlist.sh command-list.txt command-list.h: $(wildcard Documentation/git*.txt) $(QUIET_GEN)$(SHELL_PATH) ./generate-cmdlist.sh \ $(patsubst %,--exclude-program %,$(EXCLUDED_PROGRAMS)) \ - command-list.txt >$@ + . $@ hook-list.h: generate-hooklist.sh Documentation/githooks.txt - $(QUIET_GEN)$(SHELL_PATH) ./generate-hooklist.sh >$@ + $(QUIET_GEN)$(SHELL_PATH) ./generate-hooklist.sh . $@ SCRIPT_DEFINES = $(SHELL_PATH_SQ):$(DIFF_SQ):\ $(localedir_SQ):$(USE_GETTEXT_SCHEME):$(SANE_TOOL_PATH_SQ):\ diff --git a/contrib/buildsystems/CMakeLists.txt b/contrib/buildsystems/CMakeLists.txt index 01a23788e1..27d986eaf0 100644 --- a/contrib/buildsystems/CMakeLists.txt +++ b/contrib/buildsystems/CMakeLists.txt @@ -655,23 +655,17 @@ set(EXCLUSION_PROGS_CACHE ${EXCLUSION_PROGS} CACHE STRING "Programs not built" F if(NOT EXISTS ${CMAKE_BINARY_DIR}/command-list.h OR NOT EXCLUSION_PROGS_CACHE STREQUAL EXCLUSION_PROGS) list(REMOVE_ITEM EXCLUSION_PROGS empty) message("Generating command-list.h") - execute_process(COMMAND ${SH_EXE} ${CMAKE_SOURCE_DIR}/generate-cmdlist.sh ${EXCLUSION_PROGS} command-list.txt - WORKING_DIRECTORY ${CMAKE_SOURCE_DIR} - OUTPUT_FILE ${CMAKE_BINARY_DIR}/command-list.h) + execute_process(COMMAND ${SH_EXE} ${CMAKE_SOURCE_DIR}/generate-cmdlist.sh ${EXCLUSION_PROGS} ${CMAKE_SOURCE_DIR} ${CMAKE_BINARY_DIR}/command-list.h) endif() if(NOT EXISTS ${CMAKE_BINARY_DIR}/config-list.h) message("Generating config-list.h") - execute_process(COMMAND ${SH_EXE} ${CMAKE_SOURCE_DIR}/generate-configlist.sh - WORKING_DIRECTORY ${CMAKE_SOURCE_DIR} - OUTPUT_FILE ${CMAKE_BINARY_DIR}/config-list.h) + execute_process(COMMAND ${SH_EXE} ${CMAKE_SOURCE_DIR}/generate-configlist.sh ${CMAKE_SOURCE_DIR} ${CMAKE_BINARY_DIR}/config.list) endif() if(NOT EXISTS ${CMAKE_BINARY_DIR}/hook-list.h) message("Generating hook-list.h") - execute_process(COMMAND ${SH_EXE} ${CMAKE_SOURCE_DIR}/generate-hooklist.sh - WORKING_DIRECTORY ${CMAKE_SOURCE_DIR} - OUTPUT_FILE ${CMAKE_BINARY_DIR}/hook-list.h) + execute_process(COMMAND ${SH_EXE} ${CMAKE_SOURCE_DIR}/generate-hooklist.sh ${CMAKE_SOURCE_DIR} ${CMAKE_BINARY_DIR}/hook-list.h) endif() include_directories(${CMAKE_BINARY_DIR}) diff --git a/generate-cmdlist.sh b/generate-cmdlist.sh index 205541e0f7..b923a5aab8 100755 --- a/generate-cmdlist.sh +++ b/generate-cmdlist.sh @@ -64,7 +64,7 @@ define_category_names () { print_command_list () { echo "static struct cmdname_help command_list[] = {" - echo "$1" | + echo "$2" | while read cmd rest do synopsis= @@ -76,7 +76,7 @@ print_command_list () { break ;; esac - done <"Documentation/$cmd.txt" + done <"$1/Documentation/$cmd.txt" printf '\t{ "%s", N_("%s"), 0' "$cmd" "$synopsis" printf " | CAT_%s" $rest @@ -93,18 +93,28 @@ do shift done -commands="$(command_list "$1")" -categories="$(category_list "$commands")" +if test "$#" -ne 2 +then + die "USAGE: $0 " +fi + +SOURCE_DIR="$1" +OUTPUT="$2" + +{ + commands="$(command_list "$SOURCE_DIR"/command-list.txt)" + categories="$(category_list "$commands")" -echo "/* Automatically generated by generate-cmdlist.sh */ -struct cmdname_help { - const char *name; - const char *help; - uint32_t category; -}; -" -define_categories "$categories" -echo -define_category_names "$categories" -echo -print_command_list "$commands" + echo "/* Automatically generated by generate-cmdlist.sh */ + struct cmdname_help { + const char *name; + const char *help; + uint32_t category; + }; + " + define_categories "$categories" + echo + define_category_names "$categories" + echo + print_command_list "$SOURCE_DIR" "$commands" +} >"$OUTPUT" diff --git a/generate-configlist.sh b/generate-configlist.sh index 8692fe5cf4..512804a1ca 100755 --- a/generate-configlist.sh +++ b/generate-configlist.sh @@ -1,13 +1,19 @@ #!/bin/sh -echo "/* Automatically generated by generate-configlist.sh */" -echo +SOURCE_DIR="$1" +OUTPUT="$2" + +if test -z "$SOURCE_DIR" || ! test -d "$SOURCE_DIR" || test -z "$OUTPUT" +then + echo "USAGE: $0 " >&2 + exit 1 +fi print_config_list () { cat <"$OUTPUT" diff --git a/generate-hooklist.sh b/generate-hooklist.sh index 2f9f54eb54..0ff2a0b6fb 100755 --- a/generate-hooklist.sh +++ b/generate-hooklist.sh @@ -2,6 +2,17 @@ # # Usage: ./generate-hooklist.sh >hook-list.h +SOURCE_DIR="$1" +OUTPUT="$2" + +if test -z "$SOURCE_DIR" || ! test -d "$SOURCE_DIR" || test -z "$OUTPUT" +then + echo "USAGE: $0 " >&2 + exit 1 +fi + +{ + cat <"$OUTPUT" From patchwork Wed Oct 2 15:16:21 2024 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: Patrick Steinhardt X-Patchwork-Id: 13819943 Received: from fout-a3-smtp.messagingengine.com (fout-a3-smtp.messagingengine.com [103.168.172.146]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by smtp.subspace.kernel.org (Postfix) with ESMTPS id BF13F1D0DE6 for ; Wed, 2 Oct 2024 15:16:24 +0000 (UTC) Authentication-Results: smtp.subspace.kernel.org; arc=none smtp.client-ip=103.168.172.146 ARC-Seal: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1727882186; cv=none; b=E6yIRxVZOBL8U0i3KgEv/I6e9qyA2ksMalFQaIgsEV+SG1YpNvFAMI5H6LXsvQEt2KS4ZHntUCp+89c1hMdcHofJRoQbg0WAXlUD5aeLxAGOBoSe4TcLWYMl2SDEfIP7I0wbou+9reOszI5PzbTkGib4o51aujnofQOUnGSEKt0= ARC-Message-Signature: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1727882186; c=relaxed/simple; bh=4xJjjX41VauWh+HmFSH+Ei703mePkZgF0AvPEPskQYU=; h=Date:From:To:Cc:Subject:Message-ID:References:MIME-Version: Content-Type:Content-Disposition:In-Reply-To; b=nq9ChGk7Q86jM6/sTDyKFnhiv6loF/cJ4B9ngwRguqUKFb0stlhdgrKoEOdsFTfRSmIoqfI9pB+8MGr+iC2xih3CnJOjVo9ab7qoV10N3+UGubyKu1sjMiSYurVTQ16gaO7hIM5AKjvSn18TbSLHh+f6kh9zplNz1BAz8Ygdwbs= ARC-Authentication-Results: i=1; smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=pks.im; spf=pass smtp.mailfrom=pks.im; dkim=pass (2048-bit key) header.d=pks.im header.i=@pks.im header.b=BJVT+SRd; dkim=pass (2048-bit key) header.d=messagingengine.com header.i=@messagingengine.com header.b=cynSvaUc; arc=none smtp.client-ip=103.168.172.146 Authentication-Results: smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=pks.im Authentication-Results: smtp.subspace.kernel.org; spf=pass smtp.mailfrom=pks.im Authentication-Results: smtp.subspace.kernel.org; dkim=pass (2048-bit key) header.d=pks.im header.i=@pks.im header.b="BJVT+SRd"; dkim=pass (2048-bit key) header.d=messagingengine.com header.i=@messagingengine.com header.b="cynSvaUc" Received: from phl-compute-07.internal (phl-compute-07.phl.internal [10.202.2.47]) by mailfout.phl.internal (Postfix) with ESMTP id D8A0F13801F4; Wed, 2 Oct 2024 11:16:23 -0400 (EDT) Received: from phl-mailfrontend-02 ([10.202.2.163]) by phl-compute-07.internal (MEProxy); Wed, 02 Oct 2024 11:16:23 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=pks.im; h=cc:cc :content-type:content-type:date:date:from:from:in-reply-to :in-reply-to:message-id:mime-version:references:reply-to:subject :subject:to:to; s=fm2; t=1727882183; x=1727968583; bh=mCumH2FVTh /rBP3LOj35vhjTvAsZ4YLWajbjCgpBEFY=; b=BJVT+SRdQTdVt5yDu04pJSFO7a jxNionwMFJ3K7TivFyDYhpdPm0RQZdfhU0AinD3fboyq/exyg7WtH7W9tYkIlKn7 Vdddi20huGJ6M0WqyM0dXgd4738Nun5k3ataphKguJQ14TQaucz2syvoamafdgKQ IY7bZhDks/kDKL+0iFr69m0gN4lg9K1Zk3m8OWYJjjTe2eoRDUvFuGqYAaYZHkkV 2PZI6CIF1UHaF4HF2H11u0G5gmf4G3YvmnLHBUEXzIo2ykXkMQV9aftqKFzNkymb BycLjH+ZEimTcnQ3smprf5TQloIrkaLJ2UaVDbNnLSnEIJUL2VT5HT0flv6Q== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:cc:content-type:content-type:date:date :feedback-id:feedback-id:from:from:in-reply-to:in-reply-to :message-id:mime-version:references:reply-to:subject:subject:to :to:x-me-proxy:x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s= fm2; t=1727882183; x=1727968583; bh=mCumH2FVTh/rBP3LOj35vhjTvAsZ 4YLWajbjCgpBEFY=; b=cynSvaUch+hqx6DJEgKJG08QCoYCxllJ52fwpAseSAfs 9wE1d1h8G56BglK7yk7aMMTPSJdgSm79glGI4+FcO5wJ/HX76QeqHzIpSSlJiAJC 8HF3xgZ5Ceq1pEHRaAQFbA3IfgMzHRcHwctlJUqqwf/qdtuPtHnN4eIv4Bodg7Pk i21ra1PcGWoVfmwtRpTnUlONtwntirj7SsAugf1+AqcaJNE1FjuqcW15/NiI6rHX ukxSUn9u/GzukGCzp8lUK0qMO1f21P1vh3k9IFAvCMKQT2q21Rwr9Vg8N2hrg6FC LAb2PNFuw/udDOrmR5jUz/lDtyV7+83hYqX+ojCiIw== X-ME-Sender: X-ME-Received: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeeftddrvdduledgkedvucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfu rfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucesvcftvggtihhpihgvnh htshculddquddttddmnecujfgurhepfffhvfevuffkfhggtggujgesthdtredttddtvden ucfhrhhomheprfgrthhrihgtkhcuufhtvghinhhhrghrughtuceophhssehpkhhsrdhimh eqnecuggftrfgrthhtvghrnhepveekkeffhfeitdeludeigfejtdetvdelvdduhefgueeg udfghfeukefhjedvkedtnecuvehluhhsthgvrhfuihiivgepvdenucfrrghrrghmpehmrg hilhhfrhhomhepphhssehpkhhsrdhimhdpnhgspghrtghpthhtohepvddpmhhouggvpehs mhhtphhouhhtpdhrtghpthhtohepghhithesvhhgvghrrdhkvghrnhgvlhdrohhrghdprh gtphhtthhopegvshgthhifrghrthiisehgvghnthhoohdrohhrgh X-ME-Proxy: Feedback-ID: i197146af:Fastmail Received: by mail.messagingengine.com (Postfix) with ESMTPA; Wed, 2 Oct 2024 11:16:22 -0400 (EDT) Received: by vm-mail (OpenSMTPD) with ESMTPSA id 2223cca2 (TLSv1.3:TLS_AES_256_GCM_SHA384:256:NO); Wed, 2 Oct 2024 15:15:33 +0000 (UTC) Date: Wed, 2 Oct 2024 17:16:21 +0200 From: Patrick Steinhardt To: git@vger.kernel.org Cc: Eli Schwartz Subject: [RFC PATCH 14/21] Makefile: use common template for GIT-BUILD-OPTIONS Message-ID: References: Precedence: bulk X-Mailing-List: git@vger.kernel.org List-Id: List-Subscribe: List-Unsubscribe: MIME-Version: 1.0 Content-Disposition: inline In-Reply-To: The "GIT-BUILD-OPTIONS" file is generated by our build systems to propagate built-in features and paths to our tests. The generation is done ad-hoc, where both our Makefile and the CMake build instructions simply echo a bunch of strings into the file. This makes it very hard to figure out what variables are expected to exist and what format they have, and the written variables can easily get out of sync between build systems. Introduce a new "GIT-BUILD-OPTIONS.in" template to address this issue. This has multiple advantages: - It demonstrates which built options exist in the first place. - It can serve as a spot to document the build options. - Some build systems complain when not all variables could be substituted, alerting us of mismatches. Others don't, but if we forgot to substitute such variables we now have a bogus string that will likely cause our tests to fail, if they have any meaning in the first place. Backfill values that we didn't yet set in our CMake build instructions. While at it, remove the `SUPPORTS_SIMPLE_IPC` variable that we only set up in CMake as it isn't used anywhere. Note that this change requires us to move around the setup of TEST_OUTPUT_DIRECTORY in "test-lib.sh" such that it comes after sourcing the "GIT-BUILD-OPTIONS" file. This is the only instance I could find where we rely on ordering on variables. Signed-off-by: Patrick Steinhardt --- GIT-BUILD-OPTIONS.in | 35 +++++++++ Makefile | 106 ++++++++++------------------ contrib/buildsystems/CMakeLists.txt | 56 ++++++++++----- t/test-lib.sh | 13 ++-- 4 files changed, 117 insertions(+), 93 deletions(-) create mode 100644 GIT-BUILD-OPTIONS.in diff --git a/GIT-BUILD-OPTIONS.in b/GIT-BUILD-OPTIONS.in new file mode 100644 index 0000000000..e73cd5fa1a --- /dev/null +++ b/GIT-BUILD-OPTIONS.in @@ -0,0 +1,35 @@ +SHELL_PATH=@SHELL_PATH@ +TEST_SHELL_PATH=@TEST_SHELL_PATH@ +PERL_PATH=@PERL_PATH@ +DIFF=@DIFF@ +PYTHON_PATH=@PYTHON_PATH@ +TAR=@TAR@ +NO_CURL=@NO_CURL@ +NO_EXPAT=@NO_EXPAT@ +USE_LIBPCRE2=@USE_LIBPCRE2@ +NO_PERL=@NO_PERL@ +NO_PTHREADS=@NO_PTHREADS@ +NO_PYTHON=@NO_PYTHON@ +NO_REGEX=@NO_REGEX@ +NO_UNIX_SOCKETS=@NO_UNIX_SOCKETS@ +PAGER_ENV=@PAGER_ENV@ +SANITIZE_LEAK=@SANITIZE_LEAK@ +SANITIZE_ADDRESS=@SANITIZE_ADDRESS@ +X=@X@ +FSMONITOR_DAEMON_BACKEND=@FSMONITOR_DAEMON_BACKEND@ +FSMONITOR_OS_SETTINGS=@FSMONITOR_OS_SETTINGS@ +TEST_OUTPUT_DIRECTORY=@TEST_OUTPUT_DIRECTORY@ +GIT_TEST_OPTS=@GIT_TEST_OPTS@ +GIT_TEST_CMP=@GIT_TEST_CMP@ +GIT_TEST_CMP_USE_COPIED_CONTEXT=@GIT_TEST_CMP_USE_COPIED_CONTEXT@ +GIT_TEST_UTF8_LOCALE=@GIT_TEST_UTF8_LOCALE@ +NO_GETTEXT=@NO_GETTEXT@ +GIT_PERF_REPEAT_COUNT=@GIT_PERF_REPEAT_COUNT@ +GIT_PERF_REPO=@GIT_PERF_REPO@ +GIT_PERF_LARGE_REPO=@GIT_PERF_LARGE_REPO@ +GIT_PERF_MAKE_OPTS=@GIT_PERF_MAKE_OPTS@ +GIT_PERF_MAKE_COMMAND=@GIT_PERF_MAKE_COMMAND@ +GIT_INTEROP_MAKE_OPTS=@GIT_INTEROP_MAKE_OPTS@ +GIT_TEST_INDEX_VERSION=@GIT_TEST_INDEX_VERSION@ +GIT_TEST_PERL_FATAL_WARNINGS=@GIT_TEST_PERL_FATAL_WARNINGS@ +RUNTIME_PREFIX=@RUNTIME_PREFIX@ diff --git a/Makefile b/Makefile index d128b5b3e4..e92ecd0c51 100644 --- a/Makefile +++ b/Makefile @@ -3133,75 +3133,43 @@ GIT-LDFLAGS: FORCE # that runs GIT-BUILD-OPTIONS, and then again to protect it # and the first level quoting from the shell that runs "echo". GIT-BUILD-OPTIONS: FORCE - @echo SHELL_PATH=\''$(subst ','\'',$(SHELL_PATH_SQ))'\' >$@+ - @echo TEST_SHELL_PATH=\''$(subst ','\'',$(TEST_SHELL_PATH_SQ))'\' >>$@+ - @echo PERL_PATH=\''$(subst ','\'',$(PERL_PATH_SQ))'\' >>$@+ - @echo DIFF=\''$(subst ','\'',$(subst ','\'',$(DIFF)))'\' >>$@+ - @echo PYTHON_PATH=\''$(subst ','\'',$(PYTHON_PATH_SQ))'\' >>$@+ - @echo TAR=\''$(subst ','\'',$(subst ','\'',$(TAR)))'\' >>$@+ - @echo NO_CURL=\''$(subst ','\'',$(subst ','\'',$(NO_CURL)))'\' >>$@+ - @echo NO_EXPAT=\''$(subst ','\'',$(subst ','\'',$(NO_EXPAT)))'\' >>$@+ - @echo USE_LIBPCRE2=\''$(subst ','\'',$(subst ','\'',$(USE_LIBPCRE2)))'\' >>$@+ - @echo NO_PERL=\''$(subst ','\'',$(subst ','\'',$(NO_PERL)))'\' >>$@+ - @echo NO_PTHREADS=\''$(subst ','\'',$(subst ','\'',$(NO_PTHREADS)))'\' >>$@+ - @echo NO_PYTHON=\''$(subst ','\'',$(subst ','\'',$(NO_PYTHON)))'\' >>$@+ - @echo NO_REGEX=\''$(subst ','\'',$(subst ','\'',$(NO_REGEX)))'\' >>$@+ - @echo NO_UNIX_SOCKETS=\''$(subst ','\'',$(subst ','\'',$(NO_UNIX_SOCKETS)))'\' >>$@+ - @echo PAGER_ENV=\''$(subst ','\'',$(subst ','\'',$(PAGER_ENV)))'\' >>$@+ - @echo SANITIZE_LEAK=\''$(subst ','\'',$(subst ','\'',$(SANITIZE_LEAK)))'\' >>$@+ - @echo SANITIZE_ADDRESS=\''$(subst ','\'',$(subst ','\'',$(SANITIZE_ADDRESS)))'\' >>$@+ - @echo X=\'$(X)\' >>$@+ -ifdef FSMONITOR_DAEMON_BACKEND - @echo FSMONITOR_DAEMON_BACKEND=\''$(subst ','\'',$(subst ','\'',$(FSMONITOR_DAEMON_BACKEND)))'\' >>$@+ -endif -ifdef FSMONITOR_OS_SETTINGS - @echo FSMONITOR_OS_SETTINGS=\''$(subst ','\'',$(subst ','\'',$(FSMONITOR_OS_SETTINGS)))'\' >>$@+ -endif -ifdef TEST_OUTPUT_DIRECTORY - @echo TEST_OUTPUT_DIRECTORY=\''$(subst ','\'',$(subst ','\'',$(TEST_OUTPUT_DIRECTORY)))'\' >>$@+ -endif -ifdef GIT_TEST_OPTS - @echo GIT_TEST_OPTS=\''$(subst ','\'',$(subst ','\'',$(GIT_TEST_OPTS)))'\' >>$@+ -endif -ifdef GIT_TEST_CMP - @echo GIT_TEST_CMP=\''$(subst ','\'',$(subst ','\'',$(GIT_TEST_CMP)))'\' >>$@+ -endif -ifdef GIT_TEST_CMP_USE_COPIED_CONTEXT - @echo GIT_TEST_CMP_USE_COPIED_CONTEXT=YesPlease >>$@+ -endif -ifdef GIT_TEST_UTF8_LOCALE - @echo GIT_TEST_UTF8_LOCALE=\''$(subst ','\'',$(subst ','\'',$(GIT_TEST_UTF8_LOCALE)))'\' >>$@+ -endif - @echo NO_GETTEXT=\''$(subst ','\'',$(subst ','\'',$(NO_GETTEXT)))'\' >>$@+ -ifdef GIT_PERF_REPEAT_COUNT - @echo GIT_PERF_REPEAT_COUNT=\''$(subst ','\'',$(subst ','\'',$(GIT_PERF_REPEAT_COUNT)))'\' >>$@+ -endif -ifdef GIT_PERF_REPO - @echo GIT_PERF_REPO=\''$(subst ','\'',$(subst ','\'',$(GIT_PERF_REPO)))'\' >>$@+ -endif -ifdef GIT_PERF_LARGE_REPO - @echo GIT_PERF_LARGE_REPO=\''$(subst ','\'',$(subst ','\'',$(GIT_PERF_LARGE_REPO)))'\' >>$@+ -endif -ifdef GIT_PERF_MAKE_OPTS - @echo GIT_PERF_MAKE_OPTS=\''$(subst ','\'',$(subst ','\'',$(GIT_PERF_MAKE_OPTS)))'\' >>$@+ -endif -ifdef GIT_PERF_MAKE_COMMAND - @echo GIT_PERF_MAKE_COMMAND=\''$(subst ','\'',$(subst ','\'',$(GIT_PERF_MAKE_COMMAND)))'\' >>$@+ -endif -ifdef GIT_INTEROP_MAKE_OPTS - @echo GIT_INTEROP_MAKE_OPTS=\''$(subst ','\'',$(subst ','\'',$(GIT_INTEROP_MAKE_OPTS)))'\' >>$@+ -endif -ifdef GIT_TEST_INDEX_VERSION - @echo GIT_TEST_INDEX_VERSION=\''$(subst ','\'',$(subst ','\'',$(GIT_TEST_INDEX_VERSION)))'\' >>$@+ -endif -ifdef GIT_TEST_PERL_FATAL_WARNINGS - @echo GIT_TEST_PERL_FATAL_WARNINGS=\''$(subst ','\'',$(subst ','\'',$(GIT_TEST_PERL_FATAL_WARNINGS)))'\' >>$@+ -endif -ifdef RUNTIME_PREFIX - @echo RUNTIME_PREFIX=\'true\' >>$@+ -else - @echo RUNTIME_PREFIX=\'false\' >>$@+ -endif + @sed \ + -e "s|@SHELL_PATH@|\'$(SHELL_PATH_SQ)\'|" \ + -e "s|@TEST_SHELL_PATH@|\'$(TEST_SHELL_PATH_SQ)\'|" \ + -e "s|@PERL_PATH@|\'$(PERL_PATH_SQ)\'|" \ + -e "s|@DIFF@|\'$(DIFF)\'|" \ + -e "s|@PYTHON_PATH@|\'$(PYTHON_PATH_SQ)\'|" \ + -e "s|@TAR@|\'$(TAR)\'|" \ + -e "s|@NO_CURL@|\'$(NO_CURL)\'|" \ + -e "s|@NO_EXPAT@|\'$(NO_EXPAT)\'|" \ + -e "s|@USE_LIBPCRE2@|\'$(USE_LIBPCRE2)\'|" \ + -e "s|@NO_PERL@|\'$(NO_PERL)\'|" \ + -e "s|@NO_PTHREADS@|\'$(NO_PTHREADS)\'|" \ + -e "s|@NO_PYTHON@|\'$(NO_PYTHON)\'|" \ + -e "s|@NO_REGEX@|\'$(NO_REGEX)\'|" \ + -e "s|@NO_UNIX_SOCKETS@|\'$(NO_UNIX_SOCKETS)\'|" \ + -e "s|@PAGER_ENV@|\'$(PAGER_ENV)\'|" \ + -e "s|@SANITIZE_LEAK@|\'$(SANITIZE_LEAK)\'|" \ + -e "s|@SANITIZE_ADDRESS@|\'$(SANITIZE_ADDRESS)\'|" \ + -e "s|@X@|\'$(X)\'|" \ + -e "s|@FSMONITOR_DAEMON_BACKEND@|\'$(FSMONITOR_DAEMON_BACKEND)\'|" \ + -e "s|@FSMONITOR_OS_SETTINGS@|\'$(FSMONITOR_OS_SETTINGS)\'|" \ + -e "s|@TEST_OUTPUT_DIRECTORY@|\'$(TEST_OUTPUT_DIRECTORY)\'|" \ + -e "s|@GIT_TEST_OPTS@|\'$(GIT_TEST_OPTS)\'|" \ + -e "s|@GIT_TEST_CMP@|\'$(GIT_TEST_CMP)\'|" \ + -e "s|@GIT_TEST_CMP_USE_COPIED_CONTEXT@|\'$(GIT_TEST_CMP_USE_COPIED_CONTEXT)\'|" \ + -e "s|@GIT_TEST_UTF8_LOCALE@|\'$(GIT_TEST_UTF8_LOCALE)\'|" \ + -e "s|@NO_GETTEXT@|\'$(NO_GETTEXT)\'|" \ + -e "s|@GIT_PERF_REPEAT_COUNT@|\'$(GIT_PERF_REPEAT_COUNT)\'|" \ + -e "s|@GIT_PERF_REPO@|\'$(GIT_PERF_REPO)\'|" \ + -e "s|@GIT_PERF_LARGE_REPO@|\'$(GIT_PERF_LARGE_REPO)\'|" \ + -e "s|@GIT_PERF_MAKE_OPTS@|\'$(GIT_PERF_MAKE_OPTS)\'|" \ + -e "s|@GIT_PERF_MAKE_COMMAND@|\'$(GIT_PERF_MAKE_COMMAND)\'|" \ + -e "s|@GIT_INTEROP_MAKE_OPTS@|\'$(GIT_INTEROP_MAKE_OPTS)\'|" \ + -e "s|@GIT_TEST_INDEX_VERSION@|\'$(GIT_TEST_INDEX_VERSION)\'|" \ + -e "s|@GIT_TEST_PERL_FATAL_WARNINGS@|\'$(GIT_TEST_PERL_FATAL_WARNINGS)\'|" \ + -e "s|@RUNTIME_PREFIX@|\'$(RUNTIME_PREFIX)\'|" \ + GIT-BUILD-OPTIONS.in >$@+ @if cmp $@+ $@ >/dev/null 2>&1; then $(RM) $@+; else mv $@+ $@; fi @if test -f GIT-BUILD-DIR; then rm GIT-BUILD-DIR; fi diff --git a/contrib/buildsystems/CMakeLists.txt b/contrib/buildsystems/CMakeLists.txt index 27d986eaf0..2ba15155b3 100644 --- a/contrib/buildsystems/CMakeLists.txt +++ b/contrib/buildsystems/CMakeLists.txt @@ -1135,26 +1135,46 @@ if(NOT PYTHON_TESTS) set(NO_PYTHON 1) endif() -file(WRITE ${CMAKE_BINARY_DIR}/GIT-BUILD-OPTIONS "SHELL_PATH='${SHELL_PATH}'\n") -file(APPEND ${CMAKE_BINARY_DIR}/GIT-BUILD-OPTIONS "TEST_SHELL_PATH='${TEST_SHELL_PATH}'\n") -file(APPEND ${CMAKE_BINARY_DIR}/GIT-BUILD-OPTIONS "PERL_PATH='${PERL_PATH}'\n") -file(APPEND ${CMAKE_BINARY_DIR}/GIT-BUILD-OPTIONS "DIFF='${DIFF}'\n") -file(APPEND ${CMAKE_BINARY_DIR}/GIT-BUILD-OPTIONS "PYTHON_PATH='${PYTHON_PATH}'\n") -file(APPEND ${CMAKE_BINARY_DIR}/GIT-BUILD-OPTIONS "TAR='${TAR}'\n") -file(APPEND ${CMAKE_BINARY_DIR}/GIT-BUILD-OPTIONS "NO_CURL='${NO_CURL}'\n") -file(APPEND ${CMAKE_BINARY_DIR}/GIT-BUILD-OPTIONS "NO_EXPAT='${NO_EXPAT}'\n") -file(APPEND ${CMAKE_BINARY_DIR}/GIT-BUILD-OPTIONS "NO_PERL='${NO_PERL}'\n") -file(APPEND ${CMAKE_BINARY_DIR}/GIT-BUILD-OPTIONS "NO_PTHREADS='${NO_PTHREADS}'\n") -file(APPEND ${CMAKE_BINARY_DIR}/GIT-BUILD-OPTIONS "NO_UNIX_SOCKETS='${NO_UNIX_SOCKETS}'\n") -file(APPEND ${CMAKE_BINARY_DIR}/GIT-BUILD-OPTIONS "PAGER_ENV='${PAGER_ENV}'\n") -file(APPEND ${CMAKE_BINARY_DIR}/GIT-BUILD-OPTIONS "X='${EXE_EXTENSION}'\n") -file(APPEND ${CMAKE_BINARY_DIR}/GIT-BUILD-OPTIONS "NO_GETTEXT='${NO_GETTEXT}'\n") -file(APPEND ${CMAKE_BINARY_DIR}/GIT-BUILD-OPTIONS "RUNTIME_PREFIX='${RUNTIME_PREFIX}'\n") -file(APPEND ${CMAKE_BINARY_DIR}/GIT-BUILD-OPTIONS "NO_PYTHON='${NO_PYTHON}'\n") -file(APPEND ${CMAKE_BINARY_DIR}/GIT-BUILD-OPTIONS "SUPPORTS_SIMPLE_IPC='${SUPPORTS_SIMPLE_IPC}'\n") +file(STRINGS ${CMAKE_SOURCE_DIR}/GIT-BUILD-OPTIONS.in git_build_options NEWLINE_CONSUME) +string(REPLACE "@SHELL_PATH@" "${SHELL_PATH}" git_build_options "${git_build_options}") +string(REPLACE "@TEST_SHELL_PATH@" "${TEST_SHELL_PATH}" git_build_options "${git_build_options}") +string(REPLACE "@PERL_PATH@" "${PERL_PATH}" git_build_options "${git_build_options}") +string(REPLACE "@DIFF@" "${DIFF}" git_build_options "${git_build_options}") +string(REPLACE "@PYTHON_PATH@" "${PYTHON_PATH}" git_build_options "${git_build_options}") +string(REPLACE "@TAR@" "${TAR}" git_build_options "${git_build_options}") +string(REPLACE "@NO_CURL@" "${NO_CURL}" git_build_options "${git_build_options}") +string(REPLACE "@NO_EXPAT@" "${NO_EXPAT}" git_build_options "${git_build_options}") +string(REPLACE "@USE_LIBPCRE2@" "" git_build_options "${git_build_options}") +string(REPLACE "@NO_PERL@" "${NO_PERL}" git_build_options "${git_build_options}") +string(REPLACE "@NO_PTHREADS@" "${NO_PTHREADS}" git_build_options "${git_build_options}") +string(REPLACE "@NO_PYTHON@" "${NO_PYTHON}" git_build_options "${git_build_options}") +string(REPLACE "@NO_REGEX@" "" git_build_options "${git_build_options}") +string(REPLACE "@NO_UNIX_SOCKETS@" "${NO_UNIX_SOCKETS}" git_build_options "${git_build_options}") +string(REPLACE "@PAGER_ENV@" "${PAGER_ENV}" git_build_options "${git_build_options}") +string(REPLACE "@SANITIZE_LEAK@" "" git_build_options "${git_build_options}") +string(REPLACE "@SANITIZE_ADDRESS@" "" git_build_options "${git_build_options}") +string(REPLACE "@X@" "${EXE_EXTENSION}" git_build_options "${git_build_options}") +string(REPLACE "@FSMONITOR_DAEMON_BACKEND@" "win32" git_build_options "${git_build_options}") +string(REPLACE "@FSMONITOR_OS_SETTINGS@" "win32" git_build_options "${git_build_options}") +string(REPLACE "@TEST_OUTPUT_DIRECTORY@" "" git_build_options "${git_build_options}") +string(REPLACE "@GIT_TEST_OPTS@" "" git_build_options "${git_build_options}") +string(REPLACE "@GIT_TEST_CMP@" "" git_build_options "${git_build_options}") +string(REPLACE "@GIT_TEST_CMP_USE_COPIED_CONTEXT@" "" git_build_options "${git_build_options}") +string(REPLACE "@GIT_TEST_UTF8_LOCALE@" "" git_build_options "${git_build_options}") +string(REPLACE "@NO_GETTEXT@" "${NO_GETTEXT}" git_build_options "${git_build_options}") +string(REPLACE "@GIT_PERF_REPEAT_COUNT@" "" git_build_options "${git_build_options}") +string(REPLACE "@GIT_PERF_REPO@" "" git_build_options "${git_build_options}") +string(REPLACE "@GIT_PERF_LARGE_REPO@" "" git_build_options "${git_build_options}") +string(REPLACE "@GIT_PERF_MAKE_OPTS@" "" git_build_options "${git_build_options}") +string(REPLACE "@GIT_PERF_MAKE_COMMAND@" "" git_build_options "${git_build_options}") +string(REPLACE "@GIT_INTEROP_MAKE_OPTS@" "" git_build_options "${git_build_options}") +string(REPLACE "@GIT_TEST_INDEX_VERSION@" "" git_build_options "${git_build_options}") +string(REPLACE "@GIT_TEST_PERL_FATAL_WARNINGS@" "" git_build_options "${git_build_options}") +string(REPLACE "@RUNTIME_PREFIX@" "${RUNTIME_PREFIX}" git_build_options "${git_build_options}") if(USE_VCPKG) - file(APPEND ${CMAKE_BINARY_DIR}/GIT-BUILD-OPTIONS "PATH=\"$PATH:$TEST_DIRECTORY/../compat/vcbuild/vcpkg/installed/x64-windows/bin\"\n") + string(APPEND git_build_options "PATH=\"$PATH:$TEST_DIRECTORY/../compat/vcbuild/vcpkg/installed/x64-windows/bin\"\n") endif() +file(WRITE ${CMAKE_BINARY_DIR}/GIT-BUILD-OPTIONS ${git_build_options}) #Make the tests work when building out of the source tree get_filename_component(CACHE_PATH ${CMAKE_CURRENT_LIST_DIR}/../../CMakeCache.txt ABSOLUTE) diff --git a/t/test-lib.sh b/t/test-lib.sh index 5de93911b9..3fab470f3b 100644 --- a/t/test-lib.sh +++ b/t/test-lib.sh @@ -35,12 +35,6 @@ else # needing to exist. TEST_DIRECTORY=$(cd "$TEST_DIRECTORY" && pwd) || exit 1 fi -if test -z "$TEST_OUTPUT_DIRECTORY" -then - # Similarly, override this to store the test-results subdir - # elsewhere - TEST_OUTPUT_DIRECTORY=$TEST_DIRECTORY -fi GIT_BUILD_DIR="${TEST_DIRECTORY%/t}" if test "$TEST_DIRECTORY" = "$GIT_BUILD_DIR" then @@ -100,6 +94,13 @@ fi . "$GIT_BUILD_DIR"/GIT-BUILD-OPTIONS export PERL_PATH SHELL_PATH +if test -z "$TEST_OUTPUT_DIRECTORY" +then + # Similarly, override this to store the test-results subdir + # elsewhere + TEST_OUTPUT_DIRECTORY=$TEST_DIRECTORY +fi + # In t0000, we need to override test directories of nested testcases. In case # the developer has TEST_OUTPUT_DIRECTORY part of his build options, then we'd # reset this value to instead contain what the developer has specified. We thus From patchwork Wed Oct 2 15:16:23 2024 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: Patrick Steinhardt X-Patchwork-Id: 13819944 Received: from fhigh-a1-smtp.messagingengine.com (fhigh-a1-smtp.messagingengine.com [103.168.172.152]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by smtp.subspace.kernel.org (Postfix) with ESMTPS id BC8171D1502 for ; Wed, 2 Oct 2024 15:16:27 +0000 (UTC) Authentication-Results: smtp.subspace.kernel.org; arc=none smtp.client-ip=103.168.172.152 ARC-Seal: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1727882191; cv=none; b=UcmzTPl13TPtD5Qrrh+N7Kanbfrhd8mNBV7DdMtda2tvECP5I3SWV+FL0iQHCFgVjX5yjq7mbbB22WJMC7OtD7SEt8LxAi0LU35qif8SbEMUNT5GlxHgI0HavpuU1HFl9e5sW6DZKv0GwzYm/XxrEZJTJBPVJzZRT6efaWQfEVg= ARC-Message-Signature: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1727882191; c=relaxed/simple; bh=e7nTfSo4kCo4xdEa/ucXNbqxI5+SVNC21ms0Kp8DP7o=; h=Date:From:To:Cc:Subject:Message-ID:References:MIME-Version: Content-Type:Content-Disposition:In-Reply-To; b=obejZVs+1daL6jWfxpc7V6lBV75pdW0DRgVgVAz0mjT/r8VC1W4tl3Caf96ouyxo2GgjR6AwoDJ/+hP/ye/SGCSw/3PhZ6/UkSR7WBzveoPWvWubUPVG5m3UGFQ93Zk/2psDxNCRJvdlUjtkmnWzvvqBT3vkYBiiySDQ6kX6Erk= ARC-Authentication-Results: i=1; smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=pks.im; spf=pass smtp.mailfrom=pks.im; dkim=pass (2048-bit key) header.d=pks.im header.i=@pks.im header.b=alo/QxVK; dkim=pass (2048-bit key) header.d=messagingengine.com header.i=@messagingengine.com header.b=cKop6vuG; arc=none smtp.client-ip=103.168.172.152 Authentication-Results: smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=pks.im Authentication-Results: smtp.subspace.kernel.org; spf=pass smtp.mailfrom=pks.im Authentication-Results: smtp.subspace.kernel.org; dkim=pass (2048-bit key) header.d=pks.im header.i=@pks.im header.b="alo/QxVK"; dkim=pass (2048-bit key) header.d=messagingengine.com header.i=@messagingengine.com header.b="cKop6vuG" Received: from phl-compute-02.internal (phl-compute-02.phl.internal [10.202.2.42]) by mailfhigh.phl.internal (Postfix) with ESMTP id F1D75114016D; Wed, 2 Oct 2024 11:16:26 -0400 (EDT) Received: from phl-mailfrontend-02 ([10.202.2.163]) by phl-compute-02.internal (MEProxy); Wed, 02 Oct 2024 11:16:26 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=pks.im; h=cc:cc :content-type:content-type:date:date:from:from:in-reply-to :in-reply-to:message-id:mime-version:references:reply-to:subject :subject:to:to; s=fm2; t=1727882186; x=1727968586; bh=0fVpgujL30 qGh3NV63RDs3V2DcLHMWE3JWByq+xBXjM=; b=alo/QxVKjGvbycwzrrTH7lMwcA VkuX8dZvJCcQCv/TdaNsP/+ZftnaLR4Hc6Ad4cDQpt9gV5pDcgOuZEJQSAPUEXmH RzKdAmGoSlEEFkwI9Kwgi95FfMgZdvQqskgFL4oCjhcULEJuzFvxlLmH5QT4Upxx seS9+PU2Rv7qrf9mx53GrUPqugG19Zz/E6vCJxj/VGYp5cmhUks5VqTJc78HVxEi zH30Naz1Sz/fj0LZW43hLXLTdW0gb+FBbBGe1vRIOLJ7/WKwwkdyfc/o6AV9LDsr V/ehEV4tKp39n13mdo/3sliXcDXzHwtOjy9DL5ll2uafP4bupNw/LzoDHHYQ== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:cc:content-type:content-type:date:date :feedback-id:feedback-id:from:from:in-reply-to:in-reply-to :message-id:mime-version:references:reply-to:subject:subject:to :to:x-me-proxy:x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s= fm2; t=1727882186; x=1727968586; bh=0fVpgujL30qGh3NV63RDs3V2DcLH MWE3JWByq+xBXjM=; b=cKop6vuGgvGNI5SvGljQbnAnaIEtLE3rUsgVjqY/2HkL sIwyKrr5g0IYOswzvq5eNPsrQj832mgqybs0uLJiqAHadNw2Kh1sY+poH51WF0+G WuO+fGK7llq8r+kIa4UZmnzALLniQJ4qBq6pPM3bCgjuJ+UKcLxTD0japTP51ZnN XV8mGiO5Ma6ZxWmM4mS3IkdgaejyN8nDnIE2xXHopbmfIfypACIJ85ggVylE5etH aw9O5QzOycyY8YbbXfS36N+QjLtWsL32cfEYySVww0Gv1OCUByYpAc9XFqrFImix Dkz9/tEo2k7inZmVC94w6nvX1oZR9275eUx1ZINJMQ== X-ME-Sender: X-ME-Received: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeeftddrvdduledgkeefucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfu rfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucesvcftvggtihhpihgvnh htshculddquddttddmnecujfgurhepfffhvfevuffkfhggtggujgesthdtredttddtvden ucfhrhhomheprfgrthhrihgtkhcuufhtvghinhhhrghrughtuceophhssehpkhhsrdhimh eqnecuggftrfgrthhtvghrnhepteduueeiheduhffhgeekhffhhfekueeltdevuddtkedv jefhheeutdduheeghfdvnecuffhomhgrihhnpehkvghrnhgvlhdrohhrghdprghnughrvg dqshhimhhonhdruggvnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehmrghi lhhfrhhomhepphhssehpkhhsrdhimhdpnhgspghrtghpthhtohepvddpmhhouggvpehsmh htphhouhhtpdhrtghpthhtohepghhithesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgt phhtthhopegvshgthhifrghrthiisehgvghnthhoohdrohhrgh X-ME-Proxy: Feedback-ID: i197146af:Fastmail Received: by mail.messagingengine.com (Postfix) with ESMTPA; Wed, 2 Oct 2024 11:16:26 -0400 (EDT) Received: by vm-mail (OpenSMTPD) with ESMTPSA id 0037930f (TLSv1.3:TLS_AES_256_GCM_SHA384:256:NO); Wed, 2 Oct 2024 15:15:35 +0000 (UTC) Date: Wed, 2 Oct 2024 17:16:23 +0200 From: Patrick Steinhardt To: git@vger.kernel.org Cc: Eli Schwartz Subject: [RFC PATCH 15/21] Makefile: consistently use @PLACEHOLDER@ to substitute Message-ID: <6aaf3263228eefab2478e744197f7d4b651795da.1727881164.git.ps@pks.im> References: Precedence: bulk X-Mailing-List: git@vger.kernel.org List-Id: List-Subscribe: List-Unsubscribe: MIME-Version: 1.0 Content-Disposition: inline In-Reply-To: We have a bunch of placeholders in our scripts that we replace at build time, for example by using sed(1). These placeholders come in three different formats: @PLACEHOLDER@, @@PLACEHOLDER@@ and ++PLACEHOLDER++. Next to being inconsistent it also creates a bit of a problem with CMake, which only supports the first syntax. To work around that we instead manually replace such strings via string operations, which is both a hassle and also removes safeguards that CMake has to verify that we didn't forget to replace any placeholders. Besides that, other build systems like Meson also support the CMake syntax. Unify our codebase to consistently use the syntax supported by such build systems. Signed-off-by: Patrick Steinhardt --- Makefile | 42 +++++++++--------- configure.ac | 2 +- contrib/buildsystems/CMakeLists.txt | 34 +++++++------- generate-perl.sh | 2 +- git-cvsserver.perl | 2 +- git-instaweb.sh | 8 ++-- git-request-pull.sh | 2 +- git-send-email.perl | 2 +- git-sh-i18n.sh | 6 +-- git-sh-setup.sh | 6 +-- git-svn.perl | 2 +- gitk-git/po/vi.po | 2 +- gitweb/Makefile | 44 +++++++++---------- gitweb/gitweb.perl | 44 +++++++++---------- perl/Git/I18N.pm | 6 +-- perl/Git/LoadCPAN.pm | 6 +-- .../header_templates/fixed_prefix.template.pl | 2 +- .../runtime_prefix.template.pl | 8 ++-- unimplemented.sh | 2 +- wrap-for-bin.sh | 18 ++++---- 20 files changed, 120 insertions(+), 120 deletions(-) diff --git a/Makefile b/Makefile index e92ecd0c51..91e64c1222 100644 --- a/Makefile +++ b/Makefile @@ -1552,10 +1552,10 @@ endif ifdef SANE_TOOL_PATH SANE_TOOL_PATH_SQ = $(subst ','\'',$(SANE_TOOL_PATH)) -BROKEN_PATH_FIX = 's|^\# @@BROKEN_PATH_FIX@@$$|git_broken_path_fix "$(SANE_TOOL_PATH_SQ)"|' +BROKEN_PATH_FIX = 's|^\# @BROKEN_PATH_FIX@$$|git_broken_path_fix "$(SANE_TOOL_PATH_SQ)"|' PATH := $(SANE_TOOL_PATH):${PATH} else -BROKEN_PATH_FIX = '/^\# @@BROKEN_PATH_FIX@@$$/d' +BROKEN_PATH_FIX = '/^\# @BROKEN_PATH_FIX@$$/d' endif ifeq (,$(HOST_CPU)) @@ -2524,13 +2524,13 @@ GIT-SCRIPT-DEFINES: FORCE define cmd_munge_script sed -e '1s|#!.*/sh|#!$(SHELL_PATH_SQ)|' \ -e 's|@SHELL_PATH@|$(SHELL_PATH_SQ)|' \ - -e 's|@@DIFF@@|$(DIFF_SQ)|' \ - -e 's|@@LOCALEDIR@@|$(localedir_SQ)|g' \ - -e 's/@@USE_GETTEXT_SCHEME@@/$(USE_GETTEXT_SCHEME)/g' \ + -e 's|@DIFF@|$(DIFF_SQ)|' \ + -e 's|@LOCALEDIR@|$(localedir_SQ)|g' \ + -e 's/@USE_GETTEXT_SCHEME@/$(USE_GETTEXT_SCHEME)/g' \ -e $(BROKEN_PATH_FIX) \ - -e 's|@@GITWEBDIR@@|$(gitwebdir_SQ)|g' \ - -e 's|@@PERL@@|$(PERL_PATH_SQ)|g' \ - -e 's|@@PAGER_ENV@@|$(PAGER_ENV_SQ)|g' \ + -e 's|@GITWEBDIR@|$(gitwebdir_SQ)|g' \ + -e 's|@PERL@|$(PERL_PATH_SQ)|g' \ + -e 's|@PAGER_ENV@|$(PAGER_ENV_SQ)|g' \ $@.sh >$@+ endef @@ -2597,11 +2597,11 @@ GIT-PERL-HEADER: $(PERL_HEADER_TEMPLATE) GIT-PERL-DEFINES Makefile INSTLIBDIR='$(perllibdir_SQ)' && \ INSTLIBDIR_EXTRA='$(PERLLIB_EXTRA_SQ)' && \ INSTLIBDIR="$$INSTLIBDIR$${INSTLIBDIR_EXTRA:+:$$INSTLIBDIR_EXTRA}" && \ - sed -e 's=@@PATHSEP@@=$(pathsep)=g' \ - -e "s=@@INSTLIBDIR@@=$$INSTLIBDIR=g" \ - -e 's=@@PERLLIBDIR_REL@@=$(perllibdir_relative_SQ)=g' \ - -e 's=@@GITEXECDIR_REL@@=$(gitexecdir_relative_SQ)=g' \ - -e 's=@@LOCALEDIR_REL@@=$(localedir_relative_SQ)=g' \ + sed -e 's=@PATHSEP@=$(pathsep)=g' \ + -e "s=@INSTLIBDIR@=$$INSTLIBDIR=g" \ + -e 's=@PERLLIBDIR_REL@=$(perllibdir_relative_SQ)=g' \ + -e 's=@GITEXECDIR_REL@=$(gitexecdir_relative_SQ)=g' \ + -e 's=@LOCALEDIR_REL@=$(localedir_relative_SQ)=g' \ $< >$@+ && \ mv $@+ $@ @@ -2617,7 +2617,7 @@ else # NO_PERL $(SCRIPT_PERL_GEN) git-instaweb: % : unimplemented.sh $(QUIET_GEN) \ sed -e '1s|#!.*/sh|#!$(SHELL_PATH_SQ)|' \ - -e 's|@@REASON@@|NO_PERL=$(NO_PERL)|g' \ + -e 's|@REASON@|NO_PERL=$(NO_PERL)|g' \ unimplemented.sh >$@+ && \ chmod +x $@+ && \ mv $@+ $@ @@ -2638,13 +2638,13 @@ else # NO_PYTHON $(SCRIPT_PYTHON_GEN): % : unimplemented.sh $(QUIET_GEN) \ sed -e '1s|#!.*/sh|#!$(SHELL_PATH_SQ)|' \ - -e 's|@@REASON@@|NO_PYTHON=$(NO_PYTHON)|g' \ + -e 's|@REASON@|NO_PYTHON=$(NO_PYTHON)|g' \ unimplemented.sh >$@+ && \ chmod +x $@+ && \ mv $@+ $@ endif # NO_PYTHON -CONFIGURE_RECIPE = sed -e 's/@@GIT_VERSION@@/$(GIT_VERSION)/g' \ +CONFIGURE_RECIPE = sed -e 's/@GIT_VERSION@/$(GIT_VERSION)/g' \ configure.ac >configure.ac+ && \ autoconf -o configure configure.ac+ && \ $(RM) configure.ac+ @@ -3073,9 +3073,9 @@ endif perl/build/lib/%.pm: perl/%.pm GIT-PERL-DEFINES $(call mkdir_p_parent_template) $(QUIET_GEN) \ - sed -e 's|@@LOCALEDIR@@|$(perl_localedir_SQ)|g' \ - -e 's|@@NO_GETTEXT@@|$(NO_GETTEXT_SQ)|g' \ - -e 's|@@NO_PERL_CPAN_FALLBACKS@@|$(NO_PERL_CPAN_FALLBACKS_SQ)|g' \ + sed -e 's|@LOCALEDIR@|$(perl_localedir_SQ)|g' \ + -e 's|@NO_GETTEXT@|$(NO_GETTEXT_SQ)|g' \ + -e 's|@NO_PERL_CPAN_FALLBACKS@|$(NO_PERL_CPAN_FALLBACKS_SQ)|g' \ < $< > $@ perl/build/man/man3/Git.3pm: perl/Git.pm @@ -3192,8 +3192,8 @@ all:: $(TEST_PROGRAMS) $(test_bindir_programs) $(UNIT_TEST_PROGS) $(CLAR_TEST_PR bin-wrappers/%: wrap-for-bin.sh $(call mkdir_p_parent_template) $(QUIET_GEN)sed -e '1s|#!.*/sh|#!$(SHELL_PATH_SQ)|' \ - -e 's|@@BUILD_DIR@@|$(shell pwd)|' \ - -e 's|@@PROG@@|$(patsubst test-%,t/helper/test-%,$(@F))$(if $(filter-out $(BINDIR_PROGRAMS_NO_X),$(@F)),$(X),)|' < $< > $@ && \ + -e 's|@BUILD_DIR@|$(shell pwd)|' \ + -e 's|@PROG@|$(patsubst test-%,t/helper/test-%,$(@F))$(if $(filter-out $(BINDIR_PROGRAMS_NO_X),$(@F)),$(X),)|' < $< > $@ && \ chmod +x $@ # GNU make supports exporting all variables by "export" without parameters. diff --git a/configure.ac b/configure.ac index d1a96da14e..5923edc44a 100644 --- a/configure.ac +++ b/configure.ac @@ -142,7 +142,7 @@ fi ## Configure body starts here. AC_PREREQ(2.59) -AC_INIT([git], [@@GIT_VERSION@@], [git@vger.kernel.org]) +AC_INIT([git], [@GIT_VERSION@], [git@vger.kernel.org]) AC_CONFIG_SRCDIR([git.c]) diff --git a/contrib/buildsystems/CMakeLists.txt b/contrib/buildsystems/CMakeLists.txt index 2ba15155b3..bf029b9428 100644 --- a/contrib/buildsystems/CMakeLists.txt +++ b/contrib/buildsystems/CMakeLists.txt @@ -833,14 +833,14 @@ set(git_shell_scripts foreach(script ${git_shell_scripts}) file(STRINGS ${CMAKE_SOURCE_DIR}/${script}.sh content NEWLINE_CONSUME) string(REPLACE "@SHELL_PATH@" "${SHELL_PATH}" content "${content}") - string(REPLACE "@@DIFF@@" "diff" content "${content}") + string(REPLACE "@DIFF@" "diff" content "${content}") string(REPLACE "@LOCALEDIR@" "${LOCALEDIR}" content "${content}") string(REPLACE "@GITWEBDIR@" "${GITWEBDIR}" content "${content}") - string(REPLACE "@@NO_CURL@@" "" content "${content}") - string(REPLACE "@@USE_GETTEXT_SCHEME@@" "" content "${content}") - string(REPLACE "# @@BROKEN_PATH_FIX@@" "" content "${content}") - string(REPLACE "@@PERL@@" "${PERL_PATH}" content "${content}") - string(REPLACE "@@PAGER_ENV@@" "LESS=FRX LV=-c" content "${content}") + string(REPLACE "@NO_CURL@" "" content "${content}") + string(REPLACE "@USE_GETTEXT_SCHEME@" "" content "${content}") + string(REPLACE "# @BROKEN_PATH_FIX@" "" content "${content}") + string(REPLACE "@PERL@" "${PERL_PATH}" content "${content}") + string(REPLACE "@PAGER_ENV@" "LESS=FRX LV=-c" content "${content}") file(WRITE ${CMAKE_BINARY_DIR}/${script} ${content}) endforeach() @@ -849,13 +849,13 @@ parse_makefile_for_scripts(git_perl_scripts "SCRIPT_PERL" ".perl") #create perl header file(STRINGS ${CMAKE_SOURCE_DIR}/perl/header_templates/fixed_prefix.template.pl perl_header ) -string(REPLACE "@@PATHSEP@@" ":" perl_header "${perl_header}") -string(REPLACE "@@INSTLIBDIR@@" "${INSTLIBDIR}" perl_header "${perl_header}") +string(REPLACE "@PATHSEP@" ":" perl_header "${perl_header}") +string(REPLACE "@INSTLIBDIR@" "${INSTLIBDIR}" perl_header "${perl_header}") foreach(script ${git_perl_scripts}) file(STRINGS ${CMAKE_SOURCE_DIR}/${script}.perl content NEWLINE_CONSUME) string(REPLACE "#!/usr/bin/perl" "#!/usr/bin/perl\n${perl_header}\n" content "${content}") - string(REPLACE "@@GIT_VERSION@@" "${PROJECT_VERSION}" content "${content}") + string(REPLACE "@GIT_VERSION@" "${PROJECT_VERSION}" content "${content}") file(WRITE ${CMAKE_BINARY_DIR}/${script} ${content}) endforeach() @@ -870,8 +870,8 @@ file(GLOB_RECURSE perl_modules "${CMAKE_SOURCE_DIR}/perl/*.pm") foreach(pm ${perl_modules}) string(REPLACE "${CMAKE_SOURCE_DIR}/perl/" "" file_path ${pm}) file(STRINGS ${pm} content NEWLINE_CONSUME) - string(REPLACE "@@LOCALEDIR@@" "${LOCALEDIR}" content "${content}") - string(REPLACE "@@NO_PERL_CPAN_FALLBACKS@@" "" content "${content}") + string(REPLACE "@LOCALEDIR@" "${LOCALEDIR}" content "${content}") + string(REPLACE "@NO_PERL_CPAN_FALLBACKS@" "" content "${content}") file(WRITE ${CMAKE_BINARY_DIR}/perl/build/lib/${file_path} ${content}) #test-lib.sh requires perl/build/lib to be the build directory of perl modules endforeach() @@ -1079,21 +1079,21 @@ set(wrapper_test_scripts foreach(script ${wrapper_scripts}) file(STRINGS ${CMAKE_SOURCE_DIR}/wrap-for-bin.sh content NEWLINE_CONSUME) - string(REPLACE "@@BUILD_DIR@@" "${CMAKE_BINARY_DIR}" content "${content}") - string(REPLACE "@@PROG@@" "${script}${EXE_EXTENSION}" content "${content}") + string(REPLACE "@BUILD_DIR@" "${CMAKE_BINARY_DIR}" content "${content}") + string(REPLACE "@PROG@" "${script}${EXE_EXTENSION}" content "${content}") file(WRITE ${CMAKE_BINARY_DIR}/bin-wrappers/${script} ${content}) endforeach() foreach(script ${wrapper_test_scripts}) file(STRINGS ${CMAKE_SOURCE_DIR}/wrap-for-bin.sh content NEWLINE_CONSUME) - string(REPLACE "@@BUILD_DIR@@" "${CMAKE_BINARY_DIR}" content "${content}") - string(REPLACE "@@PROG@@" "t/helper/${script}${EXE_EXTENSION}" content "${content}") + string(REPLACE "@BUILD_DIR@" "${CMAKE_BINARY_DIR}" content "${content}") + string(REPLACE "@PROG@" "t/helper/${script}${EXE_EXTENSION}" content "${content}") file(WRITE ${CMAKE_BINARY_DIR}/bin-wrappers/${script} ${content}) endforeach() file(STRINGS ${CMAKE_SOURCE_DIR}/wrap-for-bin.sh content NEWLINE_CONSUME) -string(REPLACE "@@BUILD_DIR@@" "${CMAKE_BINARY_DIR}" content "${content}") -string(REPLACE "@@PROG@@" "git-cvsserver" content "${content}") +string(REPLACE "@BUILD_DIR@" "${CMAKE_BINARY_DIR}" content "${content}") +string(REPLACE "@PROG@" "git-cvsserver" content "${content}") file(WRITE ${CMAKE_BINARY_DIR}/bin-wrappers/git-cvsserver ${content}) #options for configuring test options diff --git a/generate-perl.sh b/generate-perl.sh index b9e04d6f42..41d78da029 100755 --- a/generate-perl.sh +++ b/generate-perl.sh @@ -17,6 +17,6 @@ sed -e '1{' \ -e " r $PERL_HEADER" \ -e ' G' \ -e '}' \ - -e "s/@@GIT_VERSION@@/$GIT_VERSION/g" \ + -e "s/@GIT_VERSION@/$GIT_VERSION/g" \ "$PERL_SCRIPT" >"$OUT" chmod a+x "$OUT" diff --git a/git-cvsserver.perl b/git-cvsserver.perl index 124f598bdc..70ae7cb8e4 100755 --- a/git-cvsserver.perl +++ b/git-cvsserver.perl @@ -26,7 +26,7 @@ use File::Basename; use Getopt::Long qw(:config require_order no_ignore_case); -my $VERSION = '@@GIT_VERSION@@'; +my $VERSION = '@GIT_VERSION@'; my $log = GITCVS::log->new(); my $cfg; diff --git a/git-instaweb.sh b/git-instaweb.sh index 8dbe21d588..c8efb1205a 100755 --- a/git-instaweb.sh +++ b/git-instaweb.sh @@ -3,7 +3,7 @@ # Copyright (c) 2006 Eric Wong # -PERL='@@PERL@@' +PERL='@PERL@' OPTIONS_KEEPDASHDASH= OPTIONS_STUCKLONG= OPTIONS_SPEC="\ @@ -38,8 +38,8 @@ conf="$GIT_DIR/gitweb/httpd.conf" # if installed, it doesn't need further configuration (module_path) test -z "$httpd" && httpd='lighttpd -f' -# Default is @@GITWEBDIR@@ -test -z "$root" && root='@@GITWEBDIR@@' +# Default is @GITWEBDIR@ +test -z "$root" && root='@GITWEBDIR@' # any untaken local port will do... test -z "$port" && port=1234 @@ -716,7 +716,7 @@ EOF gitweb_conf() { cat > "$fqgitdir/gitweb/gitweb_config.perl" <compile() if $ENV{'MOD_PERL'}; } -our $version = "++GIT_VERSION++"; +our $version = "@GIT_VERSION@"; our ($my_url, $my_uri, $base_url, $path_info, $home_link); sub evaluate_uri { @@ -80,46 +80,46 @@ sub evaluate_uri { # core git executable to use # this can just be "git" if your webserver has a sensible PATH -our $GIT = "++GIT_BINDIR++/git"; +our $GIT = "@GIT_BINDIR@/git"; # absolute fs-path which will be prepended to the project path #our $projectroot = "/pub/scm"; -our $projectroot = "++GITWEB_PROJECTROOT++"; +our $projectroot = "@GITWEB_PROJECTROOT@"; # fs traversing limit for getting project list # the number is relative to the projectroot -our $project_maxdepth = "++GITWEB_PROJECT_MAXDEPTH++"; +our $project_maxdepth = "@GITWEB_PROJECT_MAXDEPTH@"; # string of the home link on top of all pages -our $home_link_str = "++GITWEB_HOME_LINK_STR++"; +our $home_link_str = "@GITWEB_HOME_LINK_STR@"; # extra breadcrumbs preceding the home link our @extra_breadcrumbs = (); # name of your site or organization to appear in page titles # replace this with something more descriptive for clearer bookmarks -our $site_name = "++GITWEB_SITENAME++" +our $site_name = "@GITWEB_SITENAME@" || ($ENV{'SERVER_NAME'} || "Untitled") . " Git"; # html snippet to include in the section of each page -our $site_html_head_string = "++GITWEB_SITE_HTML_HEAD_STRING++"; +our $site_html_head_string = "@GITWEB_SITE_HTML_HEAD_STRING@"; # filename of html text to include at top of each page -our $site_header = "++GITWEB_SITE_HEADER++"; +our $site_header = "@GITWEB_SITE_HEADER@"; # html text to include at home page -our $home_text = "++GITWEB_HOMETEXT++"; +our $home_text = "@GITWEB_HOMETEXT@"; # filename of html text to include at bottom of each page -our $site_footer = "++GITWEB_SITE_FOOTER++"; +our $site_footer = "@GITWEB_SITE_FOOTER@"; # URI of stylesheets -our @stylesheets = ("++GITWEB_CSS++"); +our @stylesheets = ("@GITWEB_CSS@"); # URI of a single stylesheet, which can be overridden in GITWEB_CONFIG. our $stylesheet = undef; # URI of GIT logo (72x27 size) -our $logo = "++GITWEB_LOGO++"; +our $logo = "@GITWEB_LOGO@"; # URI of GIT favicon, assumed to be image/png type -our $favicon = "++GITWEB_FAVICON++"; +our $favicon = "@GITWEB_FAVICON@"; # URI of gitweb.js (JavaScript code for gitweb) -our $javascript = "++GITWEB_JS++"; +our $javascript = "@GITWEB_JS@"; # URI and label (title) of GIT logo link #our $logo_url = "https://www.kernel.org/pub/software/scm/git/docs/"; @@ -128,7 +128,7 @@ sub evaluate_uri { our $logo_label = "git homepage"; # source of projects list -our $projects_list = "++GITWEB_LIST++"; +our $projects_list = "@GITWEB_LIST@"; # the width (in characters) of the projects list "Description" column our $projects_list_description_width = 25; @@ -147,7 +147,7 @@ sub evaluate_uri { # show repository only if this file exists # (only effective if this variable evaluates to true) -our $export_ok = "++GITWEB_EXPORT_OK++"; +our $export_ok = "@GITWEB_EXPORT_OK@"; # don't generate age column on the projects list page our $omit_age_column = 0; @@ -161,11 +161,11 @@ sub evaluate_uri { our $export_auth_hook = undef; # only allow viewing of repositories also shown on the overview page -our $strict_export = "++GITWEB_STRICT_EXPORT++"; +our $strict_export = "@GITWEB_STRICT_EXPORT@"; # list of git base URLs used for URL to where fetch project from, # i.e. full URL is "$git_base_url/$project" -our @git_base_url_list = grep { $_ ne '' } ("++GITWEB_BASE_URL++"); +our @git_base_url_list = grep { $_ ne '' } ("@GITWEB_BASE_URL@"); # default blob_plain mimetype and default charset for text/plain blob our $default_blob_plain_mimetype = 'text/plain'; @@ -200,7 +200,7 @@ sub evaluate_uri { # http://andre-simon.de/zip/download.php due to assumptions about parameters and output). # Useful if highlight is not installed on your webserver's PATH. # [Default: highlight] -our $highlight_bin = "++HIGHLIGHT_BIN++"; +our $highlight_bin = "@HIGHLIGHT_BIN@"; # information about snapshot formats that gitweb is capable of serving our %known_snapshot_formats = ( @@ -741,9 +741,9 @@ sub read_config_file { our ($GITWEB_CONFIG, $GITWEB_CONFIG_SYSTEM, $GITWEB_CONFIG_COMMON); sub evaluate_gitweb_config { - our $GITWEB_CONFIG = $ENV{'GITWEB_CONFIG'} || "++GITWEB_CONFIG++"; - our $GITWEB_CONFIG_SYSTEM = $ENV{'GITWEB_CONFIG_SYSTEM'} || "++GITWEB_CONFIG_SYSTEM++"; - our $GITWEB_CONFIG_COMMON = $ENV{'GITWEB_CONFIG_COMMON'} || "++GITWEB_CONFIG_COMMON++"; + our $GITWEB_CONFIG = $ENV{'GITWEB_CONFIG'} || "@GITWEB_CONFIG@"; + our $GITWEB_CONFIG_SYSTEM = $ENV{'GITWEB_CONFIG_SYSTEM'} || "@GITWEB_CONFIG_SYSTEM@"; + our $GITWEB_CONFIG_COMMON = $ENV{'GITWEB_CONFIG_COMMON'} || "@GITWEB_CONFIG_COMMON@"; # Protect against duplications of file names, to not read config twice. # Only one of $GITWEB_CONFIG and $GITWEB_CONFIG_SYSTEM is used, so diff --git a/perl/Git/I18N.pm b/perl/Git/I18N.pm index 5454c3a6d2..1da830c98a 100644 --- a/perl/Git/I18N.pm +++ b/perl/Git/I18N.pm @@ -20,14 +20,14 @@ BEGIN # this "'@@' [...] '@@'" pattern. use constant NO_GETTEXT_STR => '@@' . 'NO_GETTEXT' . '@@'; use constant NO_GETTEXT => ( - q[@@NO_GETTEXT@@] ne '' + q[@NO_GETTEXT@] ne '' and - q[@@NO_GETTEXT@@] ne NO_GETTEXT_STR + q[@NO_GETTEXT@] ne NO_GETTEXT_STR ); sub __bootstrap_locale_messages { our $TEXTDOMAIN = 'git'; - our $TEXTDOMAINDIR ||= $ENV{GIT_TEXTDOMAINDIR} || '@@LOCALEDIR@@'; + our $TEXTDOMAINDIR ||= $ENV{GIT_TEXTDOMAINDIR} || '@LOCALEDIR@'; die "NO_GETTEXT=" . NO_GETTEXT_STR if NO_GETTEXT; require POSIX; diff --git a/perl/Git/LoadCPAN.pm b/perl/Git/LoadCPAN.pm index 8c7fa805f9..6be99840f8 100644 --- a/perl/Git/LoadCPAN.pm +++ b/perl/Git/LoadCPAN.pm @@ -31,11 +31,11 @@ =head1 DESCRIPTION # Makefile, and allows for detecting whether the module is loaded from # perl/Git as opposed to perl/build/Git, which is useful for one-off # testing without having Error.pm et al installed. -use constant NO_PERL_CPAN_FALLBACKS_STR => '@@' . 'NO_PERL_CPAN_FALLBACKS' . '@@'; +use constant NO_PERL_CPAN_FALLBACKS_STR => '@' . 'NO_PERL_CPAN_FALLBACKS' . '@'; use constant NO_PERL_CPAN_FALLBACKS => ( - q[@@NO_PERL_CPAN_FALLBACKS@@] ne '' + q[@NO_PERL_CPAN_FALLBACKS@] ne '' and - q[@@NO_PERL_CPAN_FALLBACKS@@] ne NO_PERL_CPAN_FALLBACKS_STR + q[@NO_PERL_CPAN_FALLBACKS@] ne NO_PERL_CPAN_FALLBACKS_STR ); sub import { diff --git a/perl/header_templates/fixed_prefix.template.pl b/perl/header_templates/fixed_prefix.template.pl index 857b4391a4..d571ca5cde 100644 --- a/perl/header_templates/fixed_prefix.template.pl +++ b/perl/header_templates/fixed_prefix.template.pl @@ -1 +1 @@ -use lib (split(/@@PATHSEP@@/, $ENV{GITPERLLIB} || '@@INSTLIBDIR@@')); +use lib (split(/@PATHSEP@/, $ENV{GITPERLLIB} || '@INSTLIBDIR@')); diff --git a/perl/header_templates/runtime_prefix.template.pl b/perl/header_templates/runtime_prefix.template.pl index 9d28b3d863..e6f8e661a1 100644 --- a/perl/header_templates/runtime_prefix.template.pl +++ b/perl/header_templates/runtime_prefix.template.pl @@ -3,7 +3,7 @@ # This finds our Git::* libraries relative to the script's runtime path. sub __git_system_path { my ($relpath) = @_; - my $gitexecdir_relative = '@@GITEXECDIR_REL@@'; + my $gitexecdir_relative = '@GITEXECDIR_REL@'; # GIT_EXEC_PATH is supplied by `git` or the test suite. my $exec_path; @@ -24,11 +24,11 @@ sub __git_system_path { } BEGIN { - use lib split /@@PATHSEP@@/, + use lib split /@PATHSEP@/, ( $ENV{GITPERLLIB} || do { - my $perllibdir = __git_system_path('@@PERLLIBDIR_REL@@'); + my $perllibdir = __git_system_path('@PERLLIBDIR_REL@'); (-e $perllibdir) || die("Invalid system path ($relpath): $path"); $perllibdir; } @@ -36,7 +36,7 @@ BEGIN # Export the system locale directory to the I18N module. The locale directory # is only installed if NO_GETTEXT is set. - $Git::I18N::TEXTDOMAINDIR = __git_system_path('@@LOCALEDIR_REL@@'); + $Git::I18N::TEXTDOMAINDIR = __git_system_path('@LOCALEDIR_REL@'); } # END RUNTIME_PREFIX generated code. diff --git a/unimplemented.sh b/unimplemented.sh index fee21d24e8..41776b279d 100644 --- a/unimplemented.sh +++ b/unimplemented.sh @@ -1,4 +1,4 @@ #!/bin/sh -echo >&2 "fatal: git was built without support for $(basename $0) (@@REASON@@)." +echo >&2 "fatal: git was built without support for $(basename $0) (@REASON@)." exit 128 diff --git a/wrap-for-bin.sh b/wrap-for-bin.sh index 95851b85b6..7898a1c238 100644 --- a/wrap-for-bin.sh +++ b/wrap-for-bin.sh @@ -4,33 +4,33 @@ # to run test suite against sandbox, but with only bindir-installed # executables in PATH. The Makefile copies this into various # files in bin-wrappers, substituting -# @@BUILD_DIR@@ and @@PROG@@. +# @BUILD_DIR@ and @PROG@. -GIT_EXEC_PATH='@@BUILD_DIR@@' +GIT_EXEC_PATH='@BUILD_DIR@' if test -n "$NO_SET_GIT_TEMPLATE_DIR" then unset GIT_TEMPLATE_DIR else - GIT_TEMPLATE_DIR='@@BUILD_DIR@@/templates/blt' + GIT_TEMPLATE_DIR='@BUILD_DIR@/templates/blt' export GIT_TEMPLATE_DIR fi -GITPERLLIB='@@BUILD_DIR@@/perl/build/lib'"${GITPERLLIB:+:$GITPERLLIB}" -GIT_TEXTDOMAINDIR='@@BUILD_DIR@@/po/build/locale' -PATH='@@BUILD_DIR@@/bin-wrappers:'"$PATH" +GITPERLLIB='@BUILD_DIR@/perl/build/lib'"${GITPERLLIB:+:$GITPERLLIB}" +GIT_TEXTDOMAINDIR='@BUILD_DIR@/po/build/locale' +PATH='@BUILD_DIR@/bin-wrappers:'"$PATH" export GIT_EXEC_PATH GITPERLLIB PATH GIT_TEXTDOMAINDIR case "$GIT_DEBUGGER" in '') - exec "${GIT_EXEC_PATH}/@@PROG@@" "$@" + exec "${GIT_EXEC_PATH}/@PROG@" "$@" ;; 1) unset GIT_DEBUGGER - exec gdb --args "${GIT_EXEC_PATH}/@@PROG@@" "$@" + exec gdb --args "${GIT_EXEC_PATH}/@PROG@" "$@" ;; *) GIT_DEBUGGER_ARGS="$GIT_DEBUGGER" unset GIT_DEBUGGER - exec ${GIT_DEBUGGER_ARGS} "${GIT_EXEC_PATH}/@@PROG@@" "$@" + exec ${GIT_DEBUGGER_ARGS} "${GIT_EXEC_PATH}/@PROG@" "$@" ;; esac From patchwork Wed Oct 2 15:16:26 2024 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: Patrick Steinhardt X-Patchwork-Id: 13819945 Received: from fhigh-a1-smtp.messagingengine.com (fhigh-a1-smtp.messagingengine.com [103.168.172.152]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by smtp.subspace.kernel.org (Postfix) with ESMTPS id C927C1D0DFE for ; Wed, 2 Oct 2024 15:16:30 +0000 (UTC) Authentication-Results: smtp.subspace.kernel.org; arc=none smtp.client-ip=103.168.172.152 ARC-Seal: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1727882192; cv=none; b=hHkkA4qok+5WXtsYvyXuGdziopxzZg7Nd6VqGuB+w4jUPLUqyetWmRT5BJigqi2ZExVu7JQEdntmfRccOvRKJbXt7riF3IsEsci7OrQY5e+tiPc9QlPoSN4vR488C2ETWQxJ9NvOZVnKGIuK2g7sIAhz9UckRh+ToeQQNqdB2L8= ARC-Message-Signature: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1727882192; c=relaxed/simple; bh=FLAOOctICLznyGG1XS95Hf2Mxd8jY0egsLxQR4coKW4=; h=Date:From:To:Cc:Subject:Message-ID:References:MIME-Version: Content-Type:Content-Disposition:In-Reply-To; b=FenfSv1cOqR/gRMm3xOGBrWOztNbAkp7sa0//Np2vwaFHKc8kB1NsRdBfhhJthlqvd+QB/Y0wSoiu5QQK/0uhSTGs8lgFO3eogZ4MYusy6IWl1N2Dl6BXt6l/uruxXVb/RI+XB78zgxboegpm5UbQUBN1FWeiPTu2nzDHCw+CTY= ARC-Authentication-Results: i=1; smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=pks.im; spf=pass smtp.mailfrom=pks.im; dkim=pass (2048-bit key) header.d=pks.im header.i=@pks.im header.b=C/jjh9ST; dkim=pass (2048-bit key) header.d=messagingengine.com header.i=@messagingengine.com header.b=HkEel7/l; arc=none smtp.client-ip=103.168.172.152 Authentication-Results: smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=pks.im Authentication-Results: smtp.subspace.kernel.org; spf=pass smtp.mailfrom=pks.im Authentication-Results: smtp.subspace.kernel.org; dkim=pass (2048-bit key) header.d=pks.im header.i=@pks.im header.b="C/jjh9ST"; dkim=pass (2048-bit key) header.d=messagingengine.com header.i=@messagingengine.com header.b="HkEel7/l" Received: from phl-compute-09.internal (phl-compute-09.phl.internal [10.202.2.49]) by mailfhigh.phl.internal (Postfix) with ESMTP id 002661140185; Wed, 2 Oct 2024 11:16:30 -0400 (EDT) Received: from phl-mailfrontend-02 ([10.202.2.163]) by phl-compute-09.internal (MEProxy); Wed, 02 Oct 2024 11:16:29 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=pks.im; h=cc:cc :content-type:content-type:date:date:from:from:in-reply-to :in-reply-to:message-id:mime-version:references:reply-to:subject :subject:to:to; s=fm2; t=1727882189; x=1727968589; bh=hsctdS/VZS Q0w7fagrRSqyAwAfhk/NfFpVuADGGvIjA=; b=C/jjh9STGn2mrmvPMyJku0PQZi Ip788LqN3UPiFK9jZnw17hzLf7sLz77v4liUh55N0TKTPSssbrjBcdOQIh3bmbmJ hlC5mDfU6bpbOFetIWYdVV+uCFDpNv/QuuUeXGRyUz3cnjyBgBPDu++VYypFlHtl fwuXvWjcnLwoJOI1g68/f00d11QadXytX7z7Ev1RQysSs8XE0dcPBcV50i14b1d0 iLvSmuFMC3lyKoXQJ95x8fv6JlqTbUDp8tP7MYKl9s0qTM1g/1FwxEIB3ewFVtMy ACM7Pu8tEUSq/95NCtwFMAcieKhtvQeMsFawXZEdivAUkc0NCq6NfGkNIEEQ== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:cc:content-type:content-type:date:date :feedback-id:feedback-id:from:from:in-reply-to:in-reply-to :message-id:mime-version:references:reply-to:subject:subject:to :to:x-me-proxy:x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s= fm2; t=1727882189; x=1727968589; bh=hsctdS/VZSQ0w7fagrRSqyAwAfhk /NfFpVuADGGvIjA=; b=HkEel7/lnCX7m4uo8oR+oXkVhR5EEyBylo0Mt6HlcmqS 1iwRLS2vaYWqFdCFwU2zBsCzbIBb2GlBan+Ni3DJd4pL35G44ePN5QkEKI9b6b/7 MJdWoqRMXBAW1qGAhDxHP1NdOMBD8IHd0T+qRaiUDK1QmLiH5EUfqhQYoaqqS0U/ amNkK6htNtM1HAFA0XczTDag7T4QIXGswp2P5m/mUAfD4JMO6oyeGiiRhmFDR4WG epXyIJTOXmyMnTTf+X0SfGKq0ppJcOnG2tkaJCC31dEPxXLE0EIjXX9lNJUB1NzS HEYx5v6z1o1yB30fz7gQfpoDxChtHWeon7iSI/y1wg== X-ME-Sender: X-ME-Received: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeeftddrvdduledgkeefucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfu rfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucesvcftvggtihhpihgvnh htshculddquddttddmnecujfgurhepfffhvfevuffkfhggtggujgesthdtredttddtvden ucfhrhhomheprfgrthhrihgtkhcuufhtvghinhhhrghrughtuceophhssehpkhhsrdhimh eqnecuggftrfgrthhtvghrnhepveekkeffhfeitdeludeigfejtdetvdelvdduhefgueeg udfghfeukefhjedvkedtnecuvehluhhsthgvrhfuihiivgepudenucfrrghrrghmpehmrg hilhhfrhhomhepphhssehpkhhsrdhimhdpnhgspghrtghpthhtohepvddpmhhouggvpehs mhhtphhouhhtpdhrtghpthhtohepghhithesvhhgvghrrdhkvghrnhgvlhdrohhrghdprh gtphhtthhopegvshgthhifrghrthiisehgvghnthhoohdrohhrgh X-ME-Proxy: Feedback-ID: i197146af:Fastmail Received: by mail.messagingengine.com (Postfix) with ESMTPA; Wed, 2 Oct 2024 11:16:29 -0400 (EDT) Received: by vm-mail (OpenSMTPD) with ESMTPSA id 60f51472 (TLSv1.3:TLS_AES_256_GCM_SHA384:256:NO); Wed, 2 Oct 2024 15:15:38 +0000 (UTC) Date: Wed, 2 Oct 2024 17:16:26 +0200 From: Patrick Steinhardt To: git@vger.kernel.org Cc: Eli Schwartz Subject: [RFC PATCH 16/21] Makefile: consistently use PERL_PATH Message-ID: <73417f39a5ecaebd53092f34e0ec4cc1f757959e.1727881164.git.ps@pks.im> References: Precedence: bulk X-Mailing-List: git@vger.kernel.org List-Id: List-Subscribe: List-Unsubscribe: MIME-Version: 1.0 Content-Disposition: inline In-Reply-To: When injecting the Perl path into our scripts we sometimes use '@PERL@' while we othertimes use '@PERL_PATH@'. Refactor the code use the latter consistently, which makes it easier to reuse the same logic for multiple scripts. Signed-off-by: Patrick Steinhardt --- Makefile | 2 +- contrib/buildsystems/CMakeLists.txt | 2 +- git-instaweb.sh | 4 ++-- git-request-pull.sh | 2 +- 4 files changed, 5 insertions(+), 5 deletions(-) diff --git a/Makefile b/Makefile index 91e64c1222..380b6a3dbc 100644 --- a/Makefile +++ b/Makefile @@ -2529,7 +2529,7 @@ sed -e '1s|#!.*/sh|#!$(SHELL_PATH_SQ)|' \ -e 's/@USE_GETTEXT_SCHEME@/$(USE_GETTEXT_SCHEME)/g' \ -e $(BROKEN_PATH_FIX) \ -e 's|@GITWEBDIR@|$(gitwebdir_SQ)|g' \ - -e 's|@PERL@|$(PERL_PATH_SQ)|g' \ + -e 's|@PERL_PATH@|$(PERL_PATH_SQ)|g' \ -e 's|@PAGER_ENV@|$(PAGER_ENV_SQ)|g' \ $@.sh >$@+ endef diff --git a/contrib/buildsystems/CMakeLists.txt b/contrib/buildsystems/CMakeLists.txt index bf029b9428..5884fa73b1 100644 --- a/contrib/buildsystems/CMakeLists.txt +++ b/contrib/buildsystems/CMakeLists.txt @@ -839,7 +839,7 @@ foreach(script ${git_shell_scripts}) string(REPLACE "@NO_CURL@" "" content "${content}") string(REPLACE "@USE_GETTEXT_SCHEME@" "" content "${content}") string(REPLACE "# @BROKEN_PATH_FIX@" "" content "${content}") - string(REPLACE "@PERL@" "${PERL_PATH}" content "${content}") + string(REPLACE "@PERL_PATH@" "${PERL_PATH}" content "${content}") string(REPLACE "@PAGER_ENV@" "LESS=FRX LV=-c" content "${content}") file(WRITE ${CMAKE_BINARY_DIR}/${script} ${content}) endforeach() diff --git a/git-instaweb.sh b/git-instaweb.sh index c8efb1205a..5ad50160bb 100755 --- a/git-instaweb.sh +++ b/git-instaweb.sh @@ -3,7 +3,7 @@ # Copyright (c) 2006 Eric Wong # -PERL='@PERL@' +PERL='@PERL_PATH@' OPTIONS_KEEPDASHDASH= OPTIONS_STUCKLONG= OPTIONS_SPEC="\ @@ -716,7 +716,7 @@ EOF gitweb_conf() { cat > "$fqgitdir/gitweb/gitweb_config.perl" < X-Patchwork-Id: 13819946 Received: from fhigh-a1-smtp.messagingengine.com (fhigh-a1-smtp.messagingengine.com [103.168.172.152]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by smtp.subspace.kernel.org (Postfix) with ESMTPS id DBA171D0DFE for ; Wed, 2 Oct 2024 15:16:35 +0000 (UTC) Authentication-Results: smtp.subspace.kernel.org; arc=none smtp.client-ip=103.168.172.152 ARC-Seal: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1727882197; cv=none; b=F0uiGlu/Kkp0k7K7lPjWDbSrQFFchS696LYc1ElgfRIqHZ0Krxq9cZZfeiw0BXxgvKBC7XxqhSgfmN2ARFsk2RIS1mN38C2VqvZAaQniSKYU2sSjbE+xtHs8JZwZOTD223JZ5mkF0CE0rbKWiKc+Ha3cgvlXEy97fnIXqqg59Bk= ARC-Message-Signature: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1727882197; c=relaxed/simple; bh=AYj/GsYyhdYE35iXmXAQ7OEyaBKjTVeXn++XSDkLzCY=; h=Date:From:To:Cc:Subject:Message-ID:References:MIME-Version: Content-Type:Content-Disposition:In-Reply-To; b=A+9nKC2/WTl65GbJ7wUI6P4JpoRIuNjNUIEyhL9Yo3lis35pQM4FMm88GSoRMleX70HkLFz2VI9H3E8wuPUfi8uFLGT5Q4G2q15CzMjaVNL+IdRg6gHHrH7IGjd+uvn4/r/j43N3nvshrF8Q0nUj9BrnDRxRzNBb8Bs0U/eB9As= ARC-Authentication-Results: i=1; smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=pks.im; spf=pass smtp.mailfrom=pks.im; dkim=pass (2048-bit key) header.d=pks.im header.i=@pks.im header.b=Y1QaGQOd; dkim=pass (2048-bit key) header.d=messagingengine.com header.i=@messagingengine.com header.b=WoewAkOQ; arc=none smtp.client-ip=103.168.172.152 Authentication-Results: smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=pks.im Authentication-Results: smtp.subspace.kernel.org; spf=pass smtp.mailfrom=pks.im Authentication-Results: smtp.subspace.kernel.org; dkim=pass (2048-bit key) header.d=pks.im header.i=@pks.im header.b="Y1QaGQOd"; dkim=pass (2048-bit key) header.d=messagingengine.com header.i=@messagingengine.com header.b="WoewAkOQ" Received: from phl-compute-10.internal (phl-compute-10.phl.internal [10.202.2.50]) by mailfhigh.phl.internal (Postfix) with ESMTP id 102171140170; Wed, 2 Oct 2024 11:16:35 -0400 (EDT) Received: from phl-mailfrontend-02 ([10.202.2.163]) by phl-compute-10.internal (MEProxy); Wed, 02 Oct 2024 11:16:35 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=pks.im; h=cc:cc :content-type:content-type:date:date:from:from:in-reply-to :in-reply-to:message-id:mime-version:references:reply-to:subject :subject:to:to; s=fm2; t=1727882195; x=1727968595; bh=/6GNTsZj0k pfb9WqHKlhNc+6YrtA9GHlv92e9zwRTZE=; b=Y1QaGQOdWtTb28FCDLGcM/U1Zp GziLSxitFNYy7iu/Twrx43oj2HjUZVGEj3OjmDtYI4nayw8TMamqIgFsDIWNjcwf fr5iFD72nrJIpg60deQNVIPRT+ay/wkqlLkWb89CXv4yNUz2z9sERGO6yIxfxhv/ /ePV564edz5LTz1yrky181H+D7714kxFqMHuyXOx2J+QKL1uTHruB7bQqzbJktYk A6sIa4Y8QSLGyW36Xu5+mSOPHLfm+uVYN6laSoRiKUN7xXfFAZqtxClK3srPyJdX D/NoX8CDoSyaDp448L6wp8GEVMKnSvwT8LIQC00YC/hH47EfIehLIHJJ/gAg== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:cc:content-type:content-type:date:date :feedback-id:feedback-id:from:from:in-reply-to:in-reply-to :message-id:mime-version:references:reply-to:subject:subject:to :to:x-me-proxy:x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s= fm2; t=1727882195; x=1727968595; bh=/6GNTsZj0kpfb9WqHKlhNc+6YrtA 9GHlv92e9zwRTZE=; b=WoewAkOQcc9BwcSXHFuzjiVYP19/vIeHOIkToFocR2n9 IMhhmm40ramBaWyYC4HaacfSO5QhzcevnHopu3utuhHOY4LObXTeqHrnD9TMmECq P+qP+nPiNNu7RWHmhXu160wrqbf6zdqvNKHtFE4tjPbipPbOqr2de04Tyn4WgWN6 xgExNtusLHhsbpX0kksumKp7jbEbnv148ES6HRK98iQu8aFbydtqspW7x2hs8JAZ 5+Cl0tBXBnQmbxMGWgw6adjwBagfN5BPmEZauylAL0bpV6FWW9i/79CVkJcPFyh9 UFP8Cyhgcop+BmkypLULtX1BgXNCLIALGXAYcXR78g== X-ME-Sender: X-ME-Received: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeeftddrvdduledgkeefucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfu rfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucesvcftvggtihhpihgvnh htshculddquddttddmnecujfgurhepfffhvfevuffkfhggtggujgesthdtredttddtvden ucfhrhhomheprfgrthhrihgtkhcuufhtvghinhhhrghrughtuceophhssehpkhhsrdhimh eqnecuggftrfgrthhtvghrnhepveekkeffhfeitdeludeigfejtdetvdelvdduhefgueeg udfghfeukefhjedvkedtnecuvehluhhsthgvrhfuihiivgepgeenucfrrghrrghmpehmrg hilhhfrhhomhepphhssehpkhhsrdhimhdpnhgspghrtghpthhtohepvddpmhhouggvpehs mhhtphhouhhtpdhrtghpthhtohepghhithesvhhgvghrrdhkvghrnhgvlhdrohhrghdprh gtphhtthhopegvshgthhifrghrthiisehgvghnthhoohdrohhrgh X-ME-Proxy: Feedback-ID: i197146af:Fastmail Received: by mail.messagingengine.com (Postfix) with ESMTPA; Wed, 2 Oct 2024 11:16:34 -0400 (EDT) Received: by vm-mail (OpenSMTPD) with ESMTPSA id 7abad843 (TLSv1.3:TLS_AES_256_GCM_SHA384:256:NO); Wed, 2 Oct 2024 15:15:43 +0000 (UTC) Date: Wed, 2 Oct 2024 17:16:28 +0200 From: Patrick Steinhardt To: git@vger.kernel.org Cc: Eli Schwartz Subject: [RFC PATCH 17/21] Makefile: allow "bin-wrappers/" directory to exist Message-ID: <4b356c0b6341741c8100cdf11e1634caa56eddc1.1727881164.git.ps@pks.im> References: Precedence: bulk X-Mailing-List: git@vger.kernel.org List-Id: List-Subscribe: List-Unsubscribe: MIME-Version: 1.0 Content-Disposition: inline In-Reply-To: The "bin-wrappers/" directory gets created by our build system and is populated with one script for each of our binaries. There isn't anything inherently wrong with the current layout, but it is somewhat hard to adapt for out-of-tree build systems. Adapt the layout such that our "bin-wrappers/" directory always exists and contains our "wrap-for-bin.sh" script to make things a little bit easier for subsequent steps. Signed-off-by: Patrick Steinhardt --- .gitignore | 1 - Documentation/CodingGuidelines | 2 +- Makefile | 6 +++--- bin-wrappers/.gitignore | 9 +++++++++ wrap-for-bin.sh => bin-wrappers/wrap-for-bin.sh | 0 contrib/buildsystems/CMakeLists.txt | 6 +++--- 6 files changed, 16 insertions(+), 8 deletions(-) create mode 100644 bin-wrappers/.gitignore rename wrap-for-bin.sh => bin-wrappers/wrap-for-bin.sh (100%) mode change 100644 => 100755 diff --git a/.gitignore b/.gitignore index 6687bd6db4..349673c55c 100644 --- a/.gitignore +++ b/.gitignore @@ -12,7 +12,6 @@ /GIT-TEST-SUITES /GIT-USER-AGENT /GIT-VERSION-FILE -/bin-wrappers/ /git /git-add /git-am diff --git a/Documentation/CodingGuidelines b/Documentation/CodingGuidelines index 3263245b03..ad83156744 100644 --- a/Documentation/CodingGuidelines +++ b/Documentation/CodingGuidelines @@ -583,7 +583,7 @@ For C programs: Run `GIT_DEBUGGER=1 ./bin-wrappers/git foo` to simply use gdb as is, or run `GIT_DEBUGGER=" " ./bin-wrappers/git foo` to use your own debugger and arguments. Example: `GIT_DEBUGGER="ddd --gdb" - ./bin-wrappers/git log` (See `wrap-for-bin.sh`.) + ./bin-wrappers/git log` (See `bin-wrappers/wrap-for-bin.sh`.) - The primary data structure that a subsystem 'S' deals with is called `struct S`. Functions that operate on `struct S` are named diff --git a/Makefile b/Makefile index 380b6a3dbc..b0c21c4c0d 100644 --- a/Makefile +++ b/Makefile @@ -3189,8 +3189,7 @@ test_bindir_programs := $(patsubst %,bin-wrappers/%,$(BINDIR_PROGRAMS_NEED_X) $( all:: $(TEST_PROGRAMS) $(test_bindir_programs) $(UNIT_TEST_PROGS) $(CLAR_TEST_PROG) -bin-wrappers/%: wrap-for-bin.sh - $(call mkdir_p_parent_template) +bin-wrappers/%: bin-wrappers/wrap-for-bin.sh $(QUIET_GEN)sed -e '1s|#!.*/sh|#!$(SHELL_PATH_SQ)|' \ -e 's|@BUILD_DIR@|$(shell pwd)|' \ -e 's|@PROG@|$(patsubst test-%,t/helper/test-%,$(@F))$(if $(filter-out $(BINDIR_PROGRAMS_NO_X),$(@F)),$(X),)|' < $< > $@ && \ @@ -3686,7 +3685,8 @@ clean: profile-clean coverage-clean cocciclean $(RM) $(FUZZ_PROGRAMS) $(RM) $(SP_OBJ) $(RM) $(HCC) - $(RM) -r bin-wrappers $(dep_dirs) $(compdb_dir) compile_commands.json + $(RM) -r $(dep_dirs) $(compdb_dir) compile_commands.json + $(RM) $(test_bindir_programs) $(RM) -r po/build/ $(RM) *.pyc *.pyo */*.pyc */*.pyo $(GENERATED_H) $(ETAGS_TARGET) tags cscope* $(RM) -r .dist-tmp-dir .doc-tmp-dir diff --git a/bin-wrappers/.gitignore b/bin-wrappers/.gitignore new file mode 100644 index 0000000000..1c6c90458b --- /dev/null +++ b/bin-wrappers/.gitignore @@ -0,0 +1,9 @@ +/git +/git-cvsserver +/git-receive-pack +/git-shell +/git-upload-archive +/git-upload-pack +/scalar +/test-fake-ssh +/test-tool diff --git a/wrap-for-bin.sh b/bin-wrappers/wrap-for-bin.sh old mode 100644 new mode 100755 similarity index 100% rename from wrap-for-bin.sh rename to bin-wrappers/wrap-for-bin.sh diff --git a/contrib/buildsystems/CMakeLists.txt b/contrib/buildsystems/CMakeLists.txt index 5884fa73b1..700f4e5160 100644 --- a/contrib/buildsystems/CMakeLists.txt +++ b/contrib/buildsystems/CMakeLists.txt @@ -1078,20 +1078,20 @@ set(wrapper_test_scripts foreach(script ${wrapper_scripts}) - file(STRINGS ${CMAKE_SOURCE_DIR}/wrap-for-bin.sh content NEWLINE_CONSUME) + file(STRINGS ${CMAKE_SOURCE_DIR}/bin-wrappers/wrap-for-bin.sh content NEWLINE_CONSUME) string(REPLACE "@BUILD_DIR@" "${CMAKE_BINARY_DIR}" content "${content}") string(REPLACE "@PROG@" "${script}${EXE_EXTENSION}" content "${content}") file(WRITE ${CMAKE_BINARY_DIR}/bin-wrappers/${script} ${content}) endforeach() foreach(script ${wrapper_test_scripts}) - file(STRINGS ${CMAKE_SOURCE_DIR}/wrap-for-bin.sh content NEWLINE_CONSUME) + file(STRINGS ${CMAKE_SOURCE_DIR}/bin-wrappers/wrap-for-bin.sh content NEWLINE_CONSUME) string(REPLACE "@BUILD_DIR@" "${CMAKE_BINARY_DIR}" content "${content}") string(REPLACE "@PROG@" "t/helper/${script}${EXE_EXTENSION}" content "${content}") file(WRITE ${CMAKE_BINARY_DIR}/bin-wrappers/${script} ${content}) endforeach() -file(STRINGS ${CMAKE_SOURCE_DIR}/wrap-for-bin.sh content NEWLINE_CONSUME) +file(STRINGS ${CMAKE_SOURCE_DIR}/bin-wrappers/wrap-for-bin.sh content NEWLINE_CONSUME) string(REPLACE "@BUILD_DIR@" "${CMAKE_BINARY_DIR}" content "${content}") string(REPLACE "@PROG@" "git-cvsserver" content "${content}") file(WRITE ${CMAKE_BINARY_DIR}/bin-wrappers/git-cvsserver ${content}) From patchwork Wed Oct 2 15:16:34 2024 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: Patrick Steinhardt X-Patchwork-Id: 13819947 Received: from fhigh-a1-smtp.messagingengine.com (fhigh-a1-smtp.messagingengine.com [103.168.172.152]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by smtp.subspace.kernel.org (Postfix) with ESMTPS id E523E1D151A for ; Wed, 2 Oct 2024 15:16:38 +0000 (UTC) Authentication-Results: smtp.subspace.kernel.org; arc=none smtp.client-ip=103.168.172.152 ARC-Seal: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1727882200; cv=none; b=J1oXEtalox8bgkrfIVBEeIWpmxKVW0MuupaLTwZRK2JIGUEuUZn0GRjnT9oHWEDQzF3IOD7Xj6S4o7XuJp11RD9PiDqFBm/Tf8Jr1oesuYqq5pvotLgXI3uPRBd5VROQjaSdS4KGgfc8+GZ05XrTP8osHPJryC2VlwUeKsTMGxc= ARC-Message-Signature: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1727882200; c=relaxed/simple; bh=ONQ8lFX03EzOwdU8+f/YPkOCHstuetxp71QNYkx+I44=; h=Date:From:To:Cc:Subject:Message-ID:References:MIME-Version: Content-Type:Content-Disposition:In-Reply-To; b=uQdJbCAzu8fRxiLJ89en3wDNBfKsXz+vC5nn+/mXVxL9051cno9mQpJ0PClX3XwUtsOsTrv9TkE8Xa68YoCr1zPoyzS1ButeKkUttHeHG8ZZZNE3xFn1ZqtLlC14jb3T0hYHo8hpZwlUTqdbrXvMvnoOmhDoudds1hQ23oEnDj8= ARC-Authentication-Results: i=1; smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=pks.im; spf=pass smtp.mailfrom=pks.im; dkim=pass (2048-bit key) header.d=pks.im header.i=@pks.im header.b=rDUmc3mO; dkim=pass (2048-bit key) header.d=messagingengine.com header.i=@messagingengine.com header.b=RsnMIfhw; arc=none smtp.client-ip=103.168.172.152 Authentication-Results: smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=pks.im Authentication-Results: smtp.subspace.kernel.org; spf=pass smtp.mailfrom=pks.im Authentication-Results: smtp.subspace.kernel.org; dkim=pass (2048-bit key) header.d=pks.im header.i=@pks.im header.b="rDUmc3mO"; dkim=pass (2048-bit key) header.d=messagingengine.com header.i=@messagingengine.com header.b="RsnMIfhw" Received: from phl-compute-09.internal (phl-compute-09.phl.internal [10.202.2.49]) by mailfhigh.phl.internal (Postfix) with ESMTP id 148E4114011E; Wed, 2 Oct 2024 11:16:38 -0400 (EDT) Received: from phl-mailfrontend-02 ([10.202.2.163]) by phl-compute-09.internal (MEProxy); Wed, 02 Oct 2024 11:16:38 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=pks.im; h=cc:cc :content-type:content-type:date:date:from:from:in-reply-to :in-reply-to:message-id:mime-version:references:reply-to:subject :subject:to:to; s=fm2; t=1727882198; x=1727968598; bh=Od8AOmZ7gz FTA2yb+TIXDB6ec2lc5v3YXMSVcddm5yc=; b=rDUmc3mO54Y7MX1Y8sVBKuW9im PvCR6DDVJWQbqR4pDd2E2Xatpa6UF5NmzY2LUTFdZD5hxIOWxK+okQpeJPdanyiq 8CZmEiMDFeVc83xbIyxZhOIWETf6eWPKeODSpCHgD9T0xuo261mKghMGA4gklsgZ XDSePWRYvq5BtCVZP2pTvXodLtjDbSiG/3q9hbm5Q59KZfaITmUmteFLSaVxWFN3 +MfNmgprPbPO/k6/KUldMjAdz8NJ6Xwaei15PfP6r9/laKngco37J22N2EPxsBdc rLSn95V0ANj+MrXJjMmD+ZtWGYAvCneVgPalvxCAWCHXq+l3XeFC0MIbzSqw== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:cc:content-type:content-type:date:date :feedback-id:feedback-id:from:from:in-reply-to:in-reply-to :message-id:mime-version:references:reply-to:subject:subject:to :to:x-me-proxy:x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s= fm2; t=1727882198; x=1727968598; bh=Od8AOmZ7gzFTA2yb+TIXDB6ec2lc 5v3YXMSVcddm5yc=; b=RsnMIfhw9NMrb28WUYqITFVd/O2osMASNzHmUlwcFaJ3 oi8eVxMspMn4EH5yTm8S5FMs8RHJwDwdEyLP0fbJZNhnFY0n2X5TtIsYeuIeb8UE e581Uo3qgsqb01ElVmUq9nMQtXNgJiAfCvBNLcimTB9tADa5PFldCX9TyfUQSODv C7IxWIZGkVgZjJz7lfeYZSZne7nPRx/ZVTx3nv7KfXXZNQJSifJ6Tdi54HhPoHxD eGiIj3bt8Vk730qr/Nd02YBuqm2vs/OagsMUNoB67cvhTOFZTg5fzU1BLlVNrTHt d6jW16cmxfB9/9f8tkPyYKYpav4dIlAKTCUPf19WeA== X-ME-Sender: X-ME-Received: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeeftddrvdduledgkeefucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfu rfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucesvcftvggtihhpihgvnh htshculddquddttddmnecujfgurhepfffhvfevuffkfhggtggujgesthdtredttddtvden ucfhrhhomheprfgrthhrihgtkhcuufhtvghinhhhrghrughtuceophhssehpkhhsrdhimh eqnecuggftrfgrthhtvghrnhepveekkeffhfeitdeludeigfejtdetvdelvdduhefgueeg udfghfeukefhjedvkedtnecuvehluhhsthgvrhfuihiivgepvdenucfrrghrrghmpehmrg hilhhfrhhomhepphhssehpkhhsrdhimhdpnhgspghrtghpthhtohepvddpmhhouggvpehs mhhtphhouhhtpdhrtghpthhtohepghhithesvhhgvghrrdhkvghrnhgvlhdrohhrghdprh gtphhtthhopegvshgthhifrghrthiisehgvghnthhoohdrohhrgh X-ME-Proxy: Feedback-ID: i197146af:Fastmail Received: by mail.messagingengine.com (Postfix) with ESMTPA; Wed, 2 Oct 2024 11:16:37 -0400 (EDT) Received: by vm-mail (OpenSMTPD) with ESMTPSA id 5158230f (TLSv1.3:TLS_AES_256_GCM_SHA384:256:NO); Wed, 2 Oct 2024 15:15:46 +0000 (UTC) Date: Wed, 2 Oct 2024 17:16:34 +0200 From: Patrick Steinhardt To: git@vger.kernel.org Cc: Eli Schwartz Subject: [RFC PATCH 18/21] Makefile: simplify building of templates Message-ID: References: Precedence: bulk X-Mailing-List: git@vger.kernel.org List-Id: List-Subscribe: List-Unsubscribe: MIME-Version: 1.0 Content-Disposition: inline In-Reply-To: When we install Git we also install a set of default templates that both git-init(1) and git-clone(1) populate into our build directories. The way the pristine templates are layed out in our source directory is somewhat weird though: instead of reconstructing the actual directory hierarchy in "templates/", we represent directory separators with "--". The only reason I could come up with for why we have this is the "branches/" directory, which is supposed to be empty when installing it. And as Git famously doesn't store empty directories at all we have to work around this limitation. Now the thing is that the "branches/" directory is a leftover to how branches used to be stored in the dark ages. gitrepository-layout(5) lists this directory as "slightly deprecated", which I would claim is a strong understatement. I have never encountered anybody using it today and would be surprised if it even works as expected. So having the "--" hack in place for an item that is basically unused, unmaintained and deprecated doesn't only feel unreasonable, but installing that entry by default may also cause confusion for users that do not know what this is supposed to be in the first place. Remove this directory from our templates and, now that we do not require the workaround anymore, restructure the templates to form a proper hierarchy. This makes it way easier for build systems to install these templates into place. We should likely think about removing support for "branch/" altogether, but that is outside of the scope of this patch series. Signed-off-by: Patrick Steinhardt --- contrib/buildsystems/CMakeLists.txt | 8 +--- templates/Makefile | 38 ++++++++++++------- templates/branches-- | 1 - templates/{this--description => description} | 0 .../applypatch-msg.sample} | 0 .../commit-msg.sample} | 0 .../fsmonitor-watchman.sample} | 0 .../post-update.sample} | 0 .../pre-applypatch.sample} | 0 .../pre-commit.sample} | 0 .../pre-merge-commit.sample} | 0 .../pre-push.sample} | 0 .../pre-rebase.sample} | 0 .../pre-receive.sample} | 0 .../prepare-commit-msg.sample} | 0 .../push-to-checkout.sample} | 0 .../sendemail-validate.sample} | 0 .../update.sample} | 0 templates/{info--exclude => info/exclude} | 0 19 files changed, 25 insertions(+), 22 deletions(-) delete mode 100644 templates/branches-- rename templates/{this--description => description} (100%) rename templates/{hooks--applypatch-msg.sample => hooks/applypatch-msg.sample} (100%) rename templates/{hooks--commit-msg.sample => hooks/commit-msg.sample} (100%) rename templates/{hooks--fsmonitor-watchman.sample => hooks/fsmonitor-watchman.sample} (100%) rename templates/{hooks--post-update.sample => hooks/post-update.sample} (100%) rename templates/{hooks--pre-applypatch.sample => hooks/pre-applypatch.sample} (100%) rename templates/{hooks--pre-commit.sample => hooks/pre-commit.sample} (100%) rename templates/{hooks--pre-merge-commit.sample => hooks/pre-merge-commit.sample} (100%) rename templates/{hooks--pre-push.sample => hooks/pre-push.sample} (100%) rename templates/{hooks--pre-rebase.sample => hooks/pre-rebase.sample} (100%) rename templates/{hooks--pre-receive.sample => hooks/pre-receive.sample} (100%) rename templates/{hooks--prepare-commit-msg.sample => hooks/prepare-commit-msg.sample} (100%) rename templates/{hooks--push-to-checkout.sample => hooks/push-to-checkout.sample} (100%) rename templates/{hooks--sendemail-validate.sample => hooks/sendemail-validate.sample} (100%) rename templates/{hooks--update.sample => hooks/update.sample} (100%) rename templates/{info--exclude => info/exclude} (100%) diff --git a/contrib/buildsystems/CMakeLists.txt b/contrib/buildsystems/CMakeLists.txt index 700f4e5160..23c2fb91ce 100644 --- a/contrib/buildsystems/CMakeLists.txt +++ b/contrib/buildsystems/CMakeLists.txt @@ -878,23 +878,17 @@ endforeach() #templates -file(GLOB templates "${CMAKE_SOURCE_DIR}/templates/*") +file(GLOB templates "${CMAKE_SOURCE_DIR}/templates/**") list(TRANSFORM templates REPLACE "${CMAKE_SOURCE_DIR}/templates/" "") list(REMOVE_ITEM templates ".gitignore") list(REMOVE_ITEM templates "Makefile") list(REMOVE_ITEM templates "blt")# Prevents an error when reconfiguring for in source builds -list(REMOVE_ITEM templates "branches--") -file(MAKE_DIRECTORY ${CMAKE_BINARY_DIR}/templates/blt/branches) #create branches - #templates have @.*@ replacement so use configure_file instead foreach(tm ${templates}) - string(REPLACE "--" "/" blt_tm ${tm}) - string(REPLACE "this" "" blt_tm ${blt_tm})# for this-- configure_file(${CMAKE_SOURCE_DIR}/templates/${tm} ${CMAKE_BINARY_DIR}/templates/blt/${blt_tm} @ONLY) endforeach() - #translations if(MSGFMT_EXE) file(GLOB po_files "${CMAKE_SOURCE_DIR}/po/*.po") diff --git a/templates/Makefile b/templates/Makefile index 367ad00c24..0b91d18925 100644 --- a/templates/Makefile +++ b/templates/Makefile @@ -29,24 +29,34 @@ all: boilerplates.made custom # in a file direc--tory--file in the source. They will be # just copied to the destination. -bpsrc = $(filter-out %~,$(wildcard *--*)) -boilerplates.made : $(bpsrc) - $(QUIET)umask 022 && ls *--* 2>/dev/null | \ - while read boilerplate; \ +TEMPLATES = description +TEMPLATES += hooks/applypatch-msg.sample +TEMPLATES += hooks/commit-msg.sample +TEMPLATES += hooks/fsmonitor-watchman.sample +TEMPLATES += hooks/post-update.sample +TEMPLATES += hooks/pre-applypatch.sample +TEMPLATES += hooks/pre-commit.sample +TEMPLATES += hooks/pre-merge-commit.sample +TEMPLATES += hooks/prepare-commit-msg.sample +TEMPLATES += hooks/pre-push.sample +TEMPLATES += hooks/pre-rebase.sample +TEMPLATES += hooks/pre-receive.sample +TEMPLATES += hooks/push-to-checkout.sample +TEMPLATES += hooks/sendemail-validate.sample +TEMPLATES += hooks/update.sample +TEMPLATES += info/exclude + +boilerplates.made: $(TEMPLATES) + $(QUIET)umask 022 && for template in $(TEMPLATES); \ do \ - case "$$boilerplate" in *~) continue ;; esac && \ - dst=`echo "$$boilerplate" | sed -e 's|^this|.|;s|--|/|g'` && \ - dir=`expr "$$dst" : '\(.*\)/'` && \ + dir=$$(dirname "$$template") && \ mkdir -p blt/$$dir && \ - case "$$boilerplate" in \ - *--) continue;; \ - esac && \ sed -e '1s|#!.*/sh|#!$(SHELL_PATH_SQ)|' \ -e 's|@SHELL_PATH@|$(SHELL_PATH_SQ)|' \ - -e 's|@PERL_PATH@|$(PERL_PATH_SQ)|g' $$boilerplate > \ - blt/$$dst && \ - if test -x "$$boilerplate"; then rx=rx; else rx=r; fi && \ - chmod a+$$rx "blt/$$dst" || exit; \ + -e 's|@PERL_PATH@|$(PERL_PATH_SQ)|g' $$template > \ + blt/$$template && \ + if test -x "$$template"; then rx=rx; else rx=r; fi && \ + chmod a+$$rx "blt/$$template" || exit; \ done && \ date >$@ diff --git a/templates/branches-- b/templates/branches-- deleted file mode 100644 index fae88709a6..0000000000 --- a/templates/branches-- +++ /dev/null @@ -1 +0,0 @@ -: this is just to ensure the directory exists. diff --git a/templates/this--description b/templates/description similarity index 100% rename from templates/this--description rename to templates/description diff --git a/templates/hooks--applypatch-msg.sample b/templates/hooks/applypatch-msg.sample similarity index 100% rename from templates/hooks--applypatch-msg.sample rename to templates/hooks/applypatch-msg.sample diff --git a/templates/hooks--commit-msg.sample b/templates/hooks/commit-msg.sample similarity index 100% rename from templates/hooks--commit-msg.sample rename to templates/hooks/commit-msg.sample diff --git a/templates/hooks--fsmonitor-watchman.sample b/templates/hooks/fsmonitor-watchman.sample similarity index 100% rename from templates/hooks--fsmonitor-watchman.sample rename to templates/hooks/fsmonitor-watchman.sample diff --git a/templates/hooks--post-update.sample b/templates/hooks/post-update.sample similarity index 100% rename from templates/hooks--post-update.sample rename to templates/hooks/post-update.sample diff --git a/templates/hooks--pre-applypatch.sample b/templates/hooks/pre-applypatch.sample similarity index 100% rename from templates/hooks--pre-applypatch.sample rename to templates/hooks/pre-applypatch.sample diff --git a/templates/hooks--pre-commit.sample b/templates/hooks/pre-commit.sample similarity index 100% rename from templates/hooks--pre-commit.sample rename to templates/hooks/pre-commit.sample diff --git a/templates/hooks--pre-merge-commit.sample b/templates/hooks/pre-merge-commit.sample similarity index 100% rename from templates/hooks--pre-merge-commit.sample rename to templates/hooks/pre-merge-commit.sample diff --git a/templates/hooks--pre-push.sample b/templates/hooks/pre-push.sample similarity index 100% rename from templates/hooks--pre-push.sample rename to templates/hooks/pre-push.sample diff --git a/templates/hooks--pre-rebase.sample b/templates/hooks/pre-rebase.sample similarity index 100% rename from templates/hooks--pre-rebase.sample rename to templates/hooks/pre-rebase.sample diff --git a/templates/hooks--pre-receive.sample b/templates/hooks/pre-receive.sample similarity index 100% rename from templates/hooks--pre-receive.sample rename to templates/hooks/pre-receive.sample diff --git a/templates/hooks--prepare-commit-msg.sample b/templates/hooks/prepare-commit-msg.sample similarity index 100% rename from templates/hooks--prepare-commit-msg.sample rename to templates/hooks/prepare-commit-msg.sample diff --git a/templates/hooks--push-to-checkout.sample b/templates/hooks/push-to-checkout.sample similarity index 100% rename from templates/hooks--push-to-checkout.sample rename to templates/hooks/push-to-checkout.sample diff --git a/templates/hooks--sendemail-validate.sample b/templates/hooks/sendemail-validate.sample similarity index 100% rename from templates/hooks--sendemail-validate.sample rename to templates/hooks/sendemail-validate.sample diff --git a/templates/hooks--update.sample b/templates/hooks/update.sample similarity index 100% rename from templates/hooks--update.sample rename to templates/hooks/update.sample diff --git a/templates/info--exclude b/templates/info/exclude similarity index 100% rename from templates/info--exclude rename to templates/info/exclude From patchwork Wed Oct 2 15:16:37 2024 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: Patrick Steinhardt X-Patchwork-Id: 13819948 Received: from fout-a3-smtp.messagingengine.com (fout-a3-smtp.messagingengine.com [103.168.172.146]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by smtp.subspace.kernel.org (Postfix) with ESMTPS id 1C02C1D1720 for ; Wed, 2 Oct 2024 15:16:41 +0000 (UTC) Authentication-Results: smtp.subspace.kernel.org; arc=none smtp.client-ip=103.168.172.146 ARC-Seal: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1727882203; cv=none; b=klkOoHdgibWvHJfcWlqMsY2BhywXVXO0s5izpdtXHeiBpBLJZQDgwJFw6ucZr7AlJoOgvf9cBZfObvrcqTzVSHod4+Tvp3SEGMEcMk9mkG8PCv1Vp99NmIjIXqfeF7fAKZtrpEPjVPHS7nZjayFiEi2jyf6KYBRI0SFGvnpcYNA= ARC-Message-Signature: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1727882203; c=relaxed/simple; bh=IDVwhURqWS2jkTw/PKwwi5Cqd3qJgNJf6uLLDcsEbWs=; h=Date:From:To:Cc:Subject:Message-ID:References:MIME-Version: Content-Type:Content-Disposition:In-Reply-To; b=eOXEHR2RwMcpjtRECgRCn0i25JeMNLbWmvjUbCYWACLm3La7MJACCDckqpMxINwDIWqz6Sxoq2COXiof3VKUZdxeWb8G8xa2XV/OxZKwdHBRklAe3mISluZxzMkBLk1VhVllWpwzXiQSJJQmWqGQAlkiRENyzLc9zQ0drCQ2r70= ARC-Authentication-Results: i=1; smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=pks.im; spf=pass smtp.mailfrom=pks.im; dkim=pass (2048-bit key) header.d=pks.im header.i=@pks.im header.b=Huyan8rq; dkim=pass (2048-bit key) header.d=messagingengine.com header.i=@messagingengine.com header.b=dQfRi8wR; arc=none smtp.client-ip=103.168.172.146 Authentication-Results: smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=pks.im Authentication-Results: smtp.subspace.kernel.org; spf=pass smtp.mailfrom=pks.im Authentication-Results: smtp.subspace.kernel.org; dkim=pass (2048-bit key) header.d=pks.im header.i=@pks.im header.b="Huyan8rq"; dkim=pass (2048-bit key) header.d=messagingengine.com header.i=@messagingengine.com header.b="dQfRi8wR" Received: from phl-compute-06.internal (phl-compute-06.phl.internal [10.202.2.46]) by mailfout.phl.internal (Postfix) with ESMTP id 37DA113801D9; Wed, 2 Oct 2024 11:16:41 -0400 (EDT) Received: from phl-mailfrontend-02 ([10.202.2.163]) by phl-compute-06.internal (MEProxy); Wed, 02 Oct 2024 11:16:41 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=pks.im; h=cc:cc :content-type:content-type:date:date:from:from:in-reply-to :in-reply-to:message-id:mime-version:references:reply-to:subject :subject:to:to; s=fm2; t=1727882201; x=1727968601; bh=ZGPsE/82zv wmi3zkjCXYTNz4sKF2+iiyahv0DtwwWZw=; b=Huyan8rqKrSozBFBKiB6F3Vp47 p+8XhH+rKm037aouKC0EnM7Eum8+6aieH4gie8KEm5IxHfy/p0uwt2TqCHmz5r84 a5FaGdp5nwH0Ck71kEhOM7/+RnL6K5jQgaiQ5Z+Bq5JXHj5tPaRw9vnfJmqe4vaf FmOim1c5QG/90tmkaiXEphAmU7UGBLRvErRTfjvLNXeuDUVR+4DOWgmjFyV5a+fH 1aSgP1PsaEh16rHEPZ1tsIPpzs5GN6hRSNzBPftk/OYvdoyiM0gsbrqD6rr0KWKi U/qYHOavuLkh7EaqkhK7G65TkL+7srgkJ2JG7hOcBxEM/aKjQ24GPZ2yGAtA== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:cc:content-type:content-type:date:date :feedback-id:feedback-id:from:from:in-reply-to:in-reply-to :message-id:mime-version:references:reply-to:subject:subject:to :to:x-me-proxy:x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s= fm2; t=1727882201; x=1727968601; bh=ZGPsE/82zvwmi3zkjCXYTNz4sKF2 +iiyahv0DtwwWZw=; b=dQfRi8wRehC79OSlNqOUuwC902S3BtAVfdv47PgqhbQ4 4Y6N9kt4NquCmoSzSPeNzzUr5CCdiwqnfGvCvd/z46wIZ6mDUMYCj2DN2g55AwqP SuSN5dyJTYwaBflKr6E6kjSSRmm8VWwv/AHGHGQk5dIrJtF7RTHednjdtLgz8lJU QsaLPf6yqZAEVqAc4CadIafG01nZQiK/AUVxyYxZ+LKruIyWHe17NWfKGW6aDGPL ukH7pMTv6P516wD2c59L6DsPm0JmczoJIHCknjYPhbiqadIIWuVMSR0dMsDcFYCx IJkwx+xHBmllTMVHXoCYZNXE1QEniJ5YofFO01fGSA== X-ME-Sender: X-ME-Received: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeeftddrvdduledgkeefucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfu rfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucesvcftvggtihhpihgvnh htshculddquddttddmnecujfgurhepfffhvfevuffkfhggtggujgesthdtredttddtvden ucfhrhhomheprfgrthhrihgtkhcuufhtvghinhhhrghrughtuceophhssehpkhhsrdhimh eqnecuggftrfgrthhtvghrnhepveekkeffhfeitdeludeigfejtdetvdelvdduhefgueeg udfghfeukefhjedvkedtnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehmrg hilhhfrhhomhepphhssehpkhhsrdhimhdpnhgspghrtghpthhtohepvddpmhhouggvpehs mhhtphhouhhtpdhrtghpthhtohepghhithesvhhgvghrrdhkvghrnhgvlhdrohhrghdprh gtphhtthhopegvshgthhifrghrthiisehgvghnthhoohdrohhrgh X-ME-Proxy: Feedback-ID: i197146af:Fastmail Received: by mail.messagingengine.com (Postfix) with ESMTPA; Wed, 2 Oct 2024 11:16:40 -0400 (EDT) Received: by vm-mail (OpenSMTPD) with ESMTPSA id dfdb323a (TLSv1.3:TLS_AES_256_GCM_SHA384:256:NO); Wed, 2 Oct 2024 15:15:49 +0000 (UTC) Date: Wed, 2 Oct 2024 17:16:37 +0200 From: Patrick Steinhardt To: git@vger.kernel.org Cc: Eli Schwartz Subject: [RFC PATCH 19/21] t: better support for out-of-tree builds Message-ID: <7a0a6b996c3dea5fd8061dd3714047bee59e566c.1727881164.git.ps@pks.im> References: Precedence: bulk X-Mailing-List: git@vger.kernel.org List-Id: List-Subscribe: List-Unsubscribe: MIME-Version: 1.0 Content-Disposition: inline In-Reply-To: Our in-tree builds used by the Makefile use various different build directories scattered around different locations. The paths to those build directories have to be propagated to our tests such that they can find the contained files. This is done via a mixture of hardcoded paths in our test library and injected variables in our bin-wrappers or "GIT-BUILD-OPTIONS". The latter two mechanisms are preferable over using hardcoded paths. For one, we have all paths which are subject to change stored in a small set of central files instead of having the knowledge of build paths in many files. And second, it allows build systems which build files elsewhere to adapt those paths based on their own needs. This is especially nice in the context of build systems that use out-of-tree builds like CMake or Meson. Remove hardcoded knowledge of build paths from our test library and move it into our bin-wrappers and "GIT-BUILD-OPTIONS". Signed-off-by: Patrick Steinhardt --- GIT-BUILD-OPTIONS.in | 5 +++++ Makefile | 9 +++++++++ bin-wrappers/wrap-for-bin.sh | 11 ++++++----- contrib/buildsystems/CMakeLists.txt | 8 ++++++++ t/lib-gettext.sh | 4 ++-- t/t7609-mergetool--lib.sh | 2 +- t/test-lib.sh | 6 +++--- 7 files changed, 34 insertions(+), 11 deletions(-) diff --git a/GIT-BUILD-OPTIONS.in b/GIT-BUILD-OPTIONS.in index e73cd5fa1a..2b3f5ef2d6 100644 --- a/GIT-BUILD-OPTIONS.in +++ b/GIT-BUILD-OPTIONS.in @@ -32,4 +32,9 @@ GIT_PERF_MAKE_COMMAND=@GIT_PERF_MAKE_COMMAND@ GIT_INTEROP_MAKE_OPTS=@GIT_INTEROP_MAKE_OPTS@ GIT_TEST_INDEX_VERSION=@GIT_TEST_INDEX_VERSION@ GIT_TEST_PERL_FATAL_WARNINGS=@GIT_TEST_PERL_FATAL_WARNINGS@ +GIT_TEST_TEXTDOMAINDIR=@GIT_TEST_TEXTDOMAINDIR@ +GIT_TEST_POPATH=@GIT_TEST_POPATH@ +GIT_TEST_TEMPLATE_DIR=@GIT_TEST_TEMPLATE_DIR@ +GIT_TEST_GITPERLLIB=@GIT_TEST_GITPERLLIB@ +GIT_TEST_MERGE_TOOLS_DIR=@GIT_TEST_MERGE_TOOLS_DIR@ RUNTIME_PREFIX=@RUNTIME_PREFIX@ diff --git a/Makefile b/Makefile index b0c21c4c0d..e6b75b6e3e 100644 --- a/Makefile +++ b/Makefile @@ -3168,6 +3168,11 @@ GIT-BUILD-OPTIONS: FORCE -e "s|@GIT_INTEROP_MAKE_OPTS@|\'$(GIT_INTEROP_MAKE_OPTS)\'|" \ -e "s|@GIT_TEST_INDEX_VERSION@|\'$(GIT_TEST_INDEX_VERSION)\'|" \ -e "s|@GIT_TEST_PERL_FATAL_WARNINGS@|\'$(GIT_TEST_PERL_FATAL_WARNINGS)\'|" \ + -e "s|@GIT_TEST_TEXTDOMAINDIR@|\'$(shell pwd)/po/build/locale\'|" \ + -e "s|@GIT_TEST_POPATH@|\'$(shell pwd)/po\'|" \ + -e "s|@GIT_TEST_TEMPLATE_DIR@|\'$(shell pwd)/templates/blt\'|" \ + -e "s|@GIT_TEST_GITPERLLIB@|\'$(shell pwd)/perl/build/lib\'|" \ + -e "s|@GIT_TEST_MERGE_TOOLS_DIR@|\'$(shell pwd)/mergetools\'|" \ -e "s|@RUNTIME_PREFIX@|\'$(RUNTIME_PREFIX)\'|" \ GIT-BUILD-OPTIONS.in >$@+ @if cmp $@+ $@ >/dev/null 2>&1; then $(RM) $@+; else mv $@+ $@; fi @@ -3192,6 +3197,10 @@ all:: $(TEST_PROGRAMS) $(test_bindir_programs) $(UNIT_TEST_PROGS) $(CLAR_TEST_PR bin-wrappers/%: bin-wrappers/wrap-for-bin.sh $(QUIET_GEN)sed -e '1s|#!.*/sh|#!$(SHELL_PATH_SQ)|' \ -e 's|@BUILD_DIR@|$(shell pwd)|' \ + -e 's|@GIT_TEXTDOMAINDIR@|$(shell pwd)/po/build/locale|' \ + -e 's|@GITPERLLIB@|$(shell pwd)/perl/build/lib|' \ + -e 's|@MERGE_TOOLS_DIR@|$(shell pwd)/mergetools|' \ + -e 's|@TEMPLATE_DIR@|$(shell pwd)/templates/blt|' \ -e 's|@PROG@|$(patsubst test-%,t/helper/test-%,$(@F))$(if $(filter-out $(BINDIR_PROGRAMS_NO_X),$(@F)),$(X),)|' < $< > $@ && \ chmod +x $@ diff --git a/bin-wrappers/wrap-for-bin.sh b/bin-wrappers/wrap-for-bin.sh index 7898a1c238..1d3a59a008 100755 --- a/bin-wrappers/wrap-for-bin.sh +++ b/bin-wrappers/wrap-for-bin.sh @@ -4,21 +4,22 @@ # to run test suite against sandbox, but with only bindir-installed # executables in PATH. The Makefile copies this into various # files in bin-wrappers, substituting -# @BUILD_DIR@ and @PROG@. +# @BUILD_DIR@, @TEMPLATE_DIR@ and @PROG@. GIT_EXEC_PATH='@BUILD_DIR@' if test -n "$NO_SET_GIT_TEMPLATE_DIR" then unset GIT_TEMPLATE_DIR else - GIT_TEMPLATE_DIR='@BUILD_DIR@/templates/blt' + GIT_TEMPLATE_DIR='@TEMPLATE_DIR@' export GIT_TEMPLATE_DIR fi -GITPERLLIB='@BUILD_DIR@/perl/build/lib'"${GITPERLLIB:+:$GITPERLLIB}" -GIT_TEXTDOMAINDIR='@BUILD_DIR@/po/build/locale' +MERGE_TOOLS_DIR='@MERGE_TOOLS_DIR@' +GITPERLLIB='@GITPERLLIB@'"${GITPERLLIB:+:$GITPERLLIB}" +GIT_TEXTDOMAINDIR='@GIT_TEXTDOMAINDIR@' PATH='@BUILD_DIR@/bin-wrappers:'"$PATH" -export GIT_EXEC_PATH GITPERLLIB PATH GIT_TEXTDOMAINDIR +export MERGE_TOOLS_DIR GIT_EXEC_PATH GITPERLLIB PATH GIT_TEXTDOMAINDIR case "$GIT_DEBUGGER" in '') diff --git a/contrib/buildsystems/CMakeLists.txt b/contrib/buildsystems/CMakeLists.txt index 23c2fb91ce..4048d3c367 100644 --- a/contrib/buildsystems/CMakeLists.txt +++ b/contrib/buildsystems/CMakeLists.txt @@ -1087,6 +1087,9 @@ endforeach() file(STRINGS ${CMAKE_SOURCE_DIR}/bin-wrappers/wrap-for-bin.sh content NEWLINE_CONSUME) string(REPLACE "@BUILD_DIR@" "${CMAKE_BINARY_DIR}" content "${content}") +string(REPLACE "@GIT_TEXTDOMAINDIR@" "${CMAKE_BINARY_DIR}/po/build/locale" content "${content}") +string(REPLACE "@GITPERLLIB@" "${CMAKE_BINARY_DIR}/perl/build/lib" content "${content}") +string(REPLACE "@MERGE_TOOLS_DIR@" "${CMAKE_SOURCE_DIR}/mergetools" content "${content}") string(REPLACE "@PROG@" "git-cvsserver" content "${content}") file(WRITE ${CMAKE_BINARY_DIR}/bin-wrappers/git-cvsserver ${content}) @@ -1165,6 +1168,11 @@ string(REPLACE "@GIT_INTEROP_MAKE_OPTS@" "" git_build_options "${git_build_optio string(REPLACE "@GIT_TEST_INDEX_VERSION@" "" git_build_options "${git_build_options}") string(REPLACE "@GIT_TEST_PERL_FATAL_WARNINGS@" "" git_build_options "${git_build_options}") string(REPLACE "@RUNTIME_PREFIX@" "${RUNTIME_PREFIX}" git_build_options "${git_build_options}") +string(REPLACE "@GIT_TEST_TEXTDOMAINDIR@" "${CMAKE_BINARY_DIR}/po/build/locale" git_build_options "${git_build_options}") +string(REPLACE "@GIT_TEST_POPATH@" "${CMAKE_BINARY_DIR}/po" git_build_options "${git_build_options}") +string(REPLACE "@GIT_TEST_TEMPLATE_DIR@" "${CMAKE_BINARY_DIR}/templates/blt" git_build_options "${git_build_options}") +string(REPLACE "@GIT_TEST_GITPERLLIB@" "${CMAKE_BINARY_DIR}/perl/build/lib" git_build_options "${git_build_options}") +string(REPLACE "@GIT_TEST_MERGE_TOOLS_DIR@" "${RUNTIME_PREFIX}" git_build_options "${git_build_options}") if(USE_VCPKG) string(APPEND git_build_options "PATH=\"$PATH:$TEST_DIRECTORY/../compat/vcbuild/vcpkg/installed/x64-windows/bin\"\n") endif() diff --git a/t/lib-gettext.sh b/t/lib-gettext.sh index cc6bb2cdea..7a734c6973 100644 --- a/t/lib-gettext.sh +++ b/t/lib-gettext.sh @@ -6,8 +6,8 @@ . ./test-lib.sh -GIT_TEXTDOMAINDIR="$GIT_BUILD_DIR/po/build/locale" -GIT_PO_PATH="$GIT_BUILD_DIR/po" +GIT_TEXTDOMAINDIR="$GIT_TEST_TEXTDOMAINDIR" +GIT_PO_PATH="$GIT_TEST_POPATH" export GIT_TEXTDOMAINDIR GIT_PO_PATH if test -n "$GIT_TEST_INSTALLED" diff --git a/t/t7609-mergetool--lib.sh b/t/t7609-mergetool--lib.sh index 8b1c3bd39f..a9273ba58d 100755 --- a/t/t7609-mergetool--lib.sh +++ b/t/t7609-mergetool--lib.sh @@ -8,7 +8,7 @@ TEST_PASSES_SANITIZE_LEAK=true . ./test-lib.sh test_expect_success 'mergetool --tool=vimdiff creates the expected layout' ' - . "$GIT_BUILD_DIR"/mergetools/vimdiff && + . "$GIT_TEST_MERGE_TOOLS_DIR"/vimdiff && run_unit_tests ' diff --git a/t/test-lib.sh b/t/test-lib.sh index 3fab470f3b..e36a21ddf7 100644 --- a/t/test-lib.sh +++ b/t/test-lib.sh @@ -1504,7 +1504,7 @@ else # normal case, use ../bin-wrappers only unless $with_dashes: PATH="$GIT_BUILD_DIR:$GIT_BUILD_DIR/t/helper:$PATH" fi fi -GIT_TEMPLATE_DIR="$GIT_BUILD_DIR"/templates/blt +GIT_TEMPLATE_DIR="$GIT_TEST_TEMPLATE_DIR" GIT_CONFIG_NOSYSTEM=1 GIT_ATTR_NOSYSTEM=1 GIT_CEILING_DIRECTORIES="$TRASH_DIRECTORY/.." @@ -1520,9 +1520,9 @@ then fi fi -GITPERLLIB="$GIT_BUILD_DIR"/perl/build/lib +GITPERLLIB="$GIT_TEST_GITPERLLIB" export GITPERLLIB -test -d "$GIT_BUILD_DIR"/templates/blt || { +test -d "$GIT_TEMPLATE_DIR" || { BAIL_OUT "You haven't built things yet, have you?" } From patchwork Wed Oct 2 15:16:40 2024 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: Patrick Steinhardt X-Patchwork-Id: 13819949 Received: from fout-a3-smtp.messagingengine.com (fout-a3-smtp.messagingengine.com [103.168.172.146]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by smtp.subspace.kernel.org (Postfix) with ESMTPS id 16F9A1D0E2C for ; Wed, 2 Oct 2024 15:16:43 +0000 (UTC) Authentication-Results: smtp.subspace.kernel.org; arc=none smtp.client-ip=103.168.172.146 ARC-Seal: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1727882205; cv=none; b=iR+2GsP7rDFg5jkD4HqjaHVD8E0EmfeKZyceJ7KWJJvfc4Gu1sJU71bHAvE9v2WcTlyleoE7iSe9ZYuWkMCqDJcae/8FOwv0C9MR3/VjCmhgii6d/8lvmE53wdWxRm5/171Sj7/4HKf3ydhSV9/vwOF+WM64BWNdeoCYULt8A60= ARC-Message-Signature: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1727882205; c=relaxed/simple; bh=8mLAAdaSmnqL8IIom6k+zH8Lgp21ZT75b8cfNJmOD/w=; h=Date:From:To:Cc:Subject:Message-ID:References:MIME-Version: Content-Type:Content-Disposition:In-Reply-To; b=Zzsch7LmiO5QryRnfusOZMEB/Ao/HFBfsmz4+adG8eda/zlvPxnsetTJsgGtb9oKtP2drSJyvxbdf2TftrS2DSKHMXSV89a1NqYRFOSSqoZS1ISkRy5vv94a9eD+fu98Zi+HjNdMjTnW2+TYTmYj5PP/TB/l1oStQV3s2TRvIUI= ARC-Authentication-Results: i=1; smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=pks.im; spf=pass smtp.mailfrom=pks.im; dkim=pass (2048-bit key) header.d=pks.im header.i=@pks.im header.b=PvjUgyFF; dkim=pass (2048-bit key) header.d=messagingengine.com header.i=@messagingengine.com header.b=QT8ddnN7; arc=none smtp.client-ip=103.168.172.146 Authentication-Results: smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=pks.im Authentication-Results: smtp.subspace.kernel.org; spf=pass smtp.mailfrom=pks.im Authentication-Results: smtp.subspace.kernel.org; dkim=pass (2048-bit key) header.d=pks.im header.i=@pks.im header.b="PvjUgyFF"; dkim=pass (2048-bit key) header.d=messagingengine.com header.i=@messagingengine.com header.b="QT8ddnN7" Received: from phl-compute-10.internal (phl-compute-10.phl.internal [10.202.2.50]) by mailfout.phl.internal (Postfix) with ESMTP id 3FA6413801F8; Wed, 2 Oct 2024 11:16:43 -0400 (EDT) Received: from phl-mailfrontend-02 ([10.202.2.163]) by phl-compute-10.internal (MEProxy); Wed, 02 Oct 2024 11:16:43 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=pks.im; h=cc:cc :content-type:content-type:date:date:from:from:in-reply-to :in-reply-to:message-id:mime-version:references:reply-to:subject :subject:to:to; s=fm2; t=1727882203; x=1727968603; bh=iOAo1ociDj bEq6ThWeb6q+NethTOJp5ixfHprP6OKWw=; b=PvjUgyFFHHBk3+ObgDYzf3uouI fx/2COyc2U4A/XBWz26pKNFEHnvDPilevUuCAcolZRxepFPFtbfe98/81u+lTNV9 86grJ9OjiBNHQoYWjkcBGVzQ7YIBpNr1pYBAlLjqcnFXVJbEetbe5m03dA6akm85 yk9x1fSpK/0AQOn9jttzSXEc8P87/shbIOYTCZWPukmbFPL0iIqU7ySDOqLi2nyK DbH2UjQ2b1nFbLy8PNYvmKJIljvN8oy2PPXQodzRX1tl5MympoCa8V+DlaNzhHyn 9XGjhNx2K4ZUYjFvAnpdEogLrojaIFSpkIKdttdIGFmlpMXNtuNA6A411xYA== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:cc:content-type:content-type:date:date :feedback-id:feedback-id:from:from:in-reply-to:in-reply-to :message-id:mime-version:references:reply-to:subject:subject:to :to:x-me-proxy:x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s= fm2; t=1727882203; x=1727968603; bh=iOAo1ociDjbEq6ThWeb6q+NethTO Jp5ixfHprP6OKWw=; b=QT8ddnN7eZePIGYHedJ1UlE/5Tc5FCXXJtcfoyb4uvM/ kGUiIg3LsKrN4FW1RHX61eXT2ztmvaFRSfT02bfMGL4Fv2929/xrF0NF4Xsv3etq KAQk6hT3JNJHiGv6ciLY7hg1hWdHiot+0qFS4FhAnsTCGpvO79ivAQPuUjp3ieuw JBhP3weZXKERfJwnwm4/S9mvqtoCBPLVUoEeAOBz5yBTL9EWB5tNZaCKiOTpwmkT WFG2LWSw4iyxWy5jLDSY5lND+hJ4S6F60GXJ5QpVOnvqfHUlfrbb1fZE4NsYHjMy 1ovY1UH0xzUg1leWnX+I89QgWNfAgIFO1r5Xc5t0sw== X-ME-Sender: X-ME-Received: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeeftddrvdduledgkeefucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfu rfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucesvcftvggtihhpihgvnh htshculddquddttddmnecujfgurhepfffhvfevuffkfhggtggujgesthdtredttddtvden ucfhrhhomheprfgrthhrihgtkhcuufhtvghinhhhrghrughtuceophhssehpkhhsrdhimh eqnecuggftrfgrthhtvghrnhepveekkeffhfeitdeludeigfejtdetvdelvdduhefgueeg udfghfeukefhjedvkedtnecuvehluhhsthgvrhfuihiivgepheenucfrrghrrghmpehmrg hilhhfrhhomhepphhssehpkhhsrdhimhdpnhgspghrtghpthhtohepvddpmhhouggvpehs mhhtphhouhhtpdhrtghpthhtohepghhithesvhhgvghrrdhkvghrnhgvlhdrohhrghdprh gtphhtthhopegvshgthhifrghrthiisehgvghnthhoohdrohhrgh X-ME-Proxy: Feedback-ID: i197146af:Fastmail Received: by mail.messagingengine.com (Postfix) with ESMTPA; Wed, 2 Oct 2024 11:16:42 -0400 (EDT) Received: by vm-mail (OpenSMTPD) with ESMTPSA id 71b2bb40 (TLSv1.3:TLS_AES_256_GCM_SHA384:256:NO); Wed, 2 Oct 2024 15:15:52 +0000 (UTC) Date: Wed, 2 Oct 2024 17:16:40 +0200 From: Patrick Steinhardt To: git@vger.kernel.org Cc: Eli Schwartz Subject: [RFC PATCH 20/21] t: allow overriding build dir Message-ID: References: Precedence: bulk X-Mailing-List: git@vger.kernel.org List-Id: List-Subscribe: List-Unsubscribe: MIME-Version: 1.0 Content-Disposition: inline In-Reply-To: Our "test-lib.sh" assumes that our build directory is the parent directory of "t/". While true when using our Makefile, it's not when using build systems that support out-of-tree builds. Allow such build systems to override the location of the build directory with an environment variable. Signed-off-by: Patrick Steinhardt --- t/test-lib.sh | 3 ++- 1 file changed, 2 insertions(+), 1 deletion(-) diff --git a/t/test-lib.sh b/t/test-lib.sh index e36a21ddf7..6f862621af 100644 --- a/t/test-lib.sh +++ b/t/test-lib.sh @@ -35,7 +35,7 @@ else # needing to exist. TEST_DIRECTORY=$(cd "$TEST_DIRECTORY" && pwd) || exit 1 fi -GIT_BUILD_DIR="${TEST_DIRECTORY%/t}" +GIT_BUILD_DIR="${GIT_BUILD_DIR:-${TEST_DIRECTORY%/t}}" if test "$TEST_DIRECTORY" = "$GIT_BUILD_DIR" then echo "PANIC: Running in a $TEST_DIRECTORY that doesn't end in '/t'?" >&2 @@ -514,6 +514,7 @@ unset VISUAL EMAIL LANGUAGE $("$PERL_PATH" -e ' PERF_ CURL_VERBOSE TRACE_CURL + BUILD_DIR )); my @vars = grep(/^GIT_/ && !/^GIT_($ok)/o, @env); print join("\n", @vars); From patchwork Wed Oct 2 15:16:42 2024 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: Patrick Steinhardt X-Patchwork-Id: 13819950 Received: from fout-a3-smtp.messagingengine.com (fout-a3-smtp.messagingengine.com [103.168.172.146]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by smtp.subspace.kernel.org (Postfix) with ESMTPS id 440551D0E25 for ; Wed, 2 Oct 2024 15:16:47 +0000 (UTC) Authentication-Results: smtp.subspace.kernel.org; arc=none smtp.client-ip=103.168.172.146 ARC-Seal: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1727882212; cv=none; b=Jq1PcGDEpgktF+3oTCKZPTb0S/3s13XYEydxbIXo79SsRyGtEMvKFEoK8Bn50kAV4vsd49TB+VSrB+Vx08hL+hCx37JXOzSLs6MBqAsVVz3Imif3397qjepF1zrUHpNXSBGvjtTqwvM0OMfNRe6GvPPQbiX030pLyPLyVoulLFo= ARC-Message-Signature: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1727882212; c=relaxed/simple; bh=4D8fLCP/YGlScFKuTl8dPfw3shl/Fj8bHKrHIY9vFTw=; h=Date:From:To:Cc:Subject:Message-ID:References:MIME-Version: Content-Type:Content-Disposition:In-Reply-To; b=t1oAARDcmB1XuY/wKyad4TKVarb1ooLhV4XSTjfHGyoblRvSCzVBVdd/VVlihTFipklai/vLikJqBokqAMaoDSKJPHerWJpWu5Ri/4upUPNVZgWxI0aU4eIkDFQE8d9Zv8gJ0fUZ23zCAfE8ucWGIlLPr4RzeWIKwIbMJwexSFk= ARC-Authentication-Results: i=1; smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=pks.im; spf=pass smtp.mailfrom=pks.im; dkim=pass (2048-bit key) header.d=pks.im header.i=@pks.im header.b=fqX9R4Bq; dkim=pass (2048-bit key) header.d=messagingengine.com header.i=@messagingengine.com header.b=Okzv2JR/; arc=none smtp.client-ip=103.168.172.146 Authentication-Results: smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=pks.im Authentication-Results: smtp.subspace.kernel.org; spf=pass smtp.mailfrom=pks.im Authentication-Results: smtp.subspace.kernel.org; dkim=pass (2048-bit key) header.d=pks.im header.i=@pks.im header.b="fqX9R4Bq"; dkim=pass (2048-bit key) header.d=messagingengine.com header.i=@messagingengine.com header.b="Okzv2JR/" Received: from phl-compute-07.internal (phl-compute-07.phl.internal [10.202.2.47]) by mailfout.phl.internal (Postfix) with ESMTP id A31F313801B5; Wed, 2 Oct 2024 11:16:46 -0400 (EDT) Received: from phl-mailfrontend-02 ([10.202.2.163]) by phl-compute-07.internal (MEProxy); Wed, 02 Oct 2024 11:16:46 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=pks.im; h=cc:cc :content-type:content-type:date:date:from:from:in-reply-to :in-reply-to:message-id:mime-version:references:reply-to:subject :subject:to:to; s=fm2; t=1727882206; x=1727968606; bh=MQuEbCEBYZ JcTaNPPLvRqWj5iDFiR2nmCijC3OjceYw=; b=fqX9R4BqXnPn9RvwnevFD2NKoh RiJkS+1byZ47bZG3L+uKk5IxSGKALgFt+RAe69FEbO0XUlsUHNLQrCqGcH8aOs3U hrl9YpP69luPqxUKqFWMvIaAoYaAC+1tA/oABMk+M3SUkSd6qLPi3ZT/X4tkTmNl WBDeT+vw+STOLLjfzpxh9DvViRtQPWgE6nk4k9BQtjjOEUqoVRf9Aobb7y5cEKjs 23Ov6MgAV8C35afn7UpKPSknuO43T9da1b1BvEKrWF5OMaY/9ObYQgzRw6Jkh3pm 9PWPwuFixxWLC7/ihZNv0Tna+XHZgFDslZDFYX9WJM+uX9Utz9rmjQLmT6nQ== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:cc:content-type:content-type:date:date :feedback-id:feedback-id:from:from:in-reply-to:in-reply-to :message-id:mime-version:references:reply-to:subject:subject:to :to:x-me-proxy:x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s= fm2; t=1727882206; x=1727968606; bh=MQuEbCEBYZJcTaNPPLvRqWj5iDFi R2nmCijC3OjceYw=; b=Okzv2JR/bt8wXcHXUsTNYU0IOGtBkGqomdAgjsuiOAyI wqg2v6HCJ/rnn/agZzAHwW2MGw0Rwngbe4SULqqQ/QcPX3CYhQfI5rTAIWi8o/tt CNdqTNk7QqrgfFU4cttZsDm7dv2Qx58qI1ipCoxSuDkQr95L7ksryTv/k0CAtSUh dG9awFeOY3UCBSk7HjcLVm328DMQ33Z/lPeel6/3lcEAoQ2F6IaFFbFuvEPJoeOa StNXQgU8++JoqF02aD+z0bBEjJEDcLjIhwva1/vofI4wlFftr4/iUkC296myTc40 Jivkj6uGvi+d0/RsB6m4e6VfZrzzf3O58zv1wltq1w== X-ME-Sender: X-ME-Received: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeeftddrvdduledgkedvucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfu rfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucesvcftvggtihhpihgvnh htshculddquddttddmnecujfgurhepfffhvfevuffkfhggtggujgesthdtredttddtvden ucfhrhhomheprfgrthhrihgtkhcuufhtvghinhhhrghrughtuceophhssehpkhhsrdhimh eqnecuggftrfgrthhtvghrnhepgffgieevgeeuledtieejhfejudfhkeevffelhfegteff vdeuffdvveeuiefhieehnecuffhomhgrihhnpehhthhtphgurdhshhdphhhtthhpqdhshh grlhhlohifrdhshhdphhhtthhpqdhpuhhshhdqfigvsggurghvrdhshhdphhhtthhpqdhp uhhshhdqshhmrghrthdrshhhpdhhthhtphdrshhhpdhhthhtphdqfhgvthgthhdqughumh gsrdhshhdphhhtthhpqdhfvghttghhqdhsmhgrrhhtrdhshhdphhhtthhpqdhsmhgrrhht qdgtohhmmhhonhdrshhhpdhhthhtphdqghgvthdrshhhpdhhthhtphdqfhgvthgthhdqsh hmrghrthdqhhhtthhpvddrshhhpdhhthhtphdqsggrtghkvghnugdqnhhoshgvrhhvvghr rdhshhdphhhtthhpqdgsrggtkhgvnhgurdhshhdphhhtthhpqdgsrggtkhgvnhguqdgtoh hnthgvnhhtqdhlvghnghhthhdrshhhpdhhthhtphdqrghuthhhrdhshhdphhhtthhpqdhp rhhogiihrdhshhdphhhtthhpqdgtuhhrlhdqvhgvrhgsohhsvgdrshhhpdhhthhtphdqsh htrghtuhhsrdhshhenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepmhgrihhl fhhrohhmpehpshesphhkshdrihhmpdhnsggprhgtphhtthhopedvpdhmohguvgepshhmth hpohhuthdprhgtphhtthhopegvshgthhifrghrthiisehgvghnthhoohdrohhrghdprhgt phhtthhopehgihhtsehvghgvrhdrkhgvrhhnvghlrdhorhhg X-ME-Proxy: Feedback-ID: i197146af:Fastmail Received: by mail.messagingengine.com (Postfix) with ESMTPA; Wed, 2 Oct 2024 11:16:45 -0400 (EDT) Received: by vm-mail (OpenSMTPD) with ESMTPSA id 604c81e2 (TLSv1.3:TLS_AES_256_GCM_SHA384:256:NO); Wed, 2 Oct 2024 15:15:55 +0000 (UTC) Date: Wed, 2 Oct 2024 17:16:42 +0200 From: Patrick Steinhardt To: git@vger.kernel.org Cc: Eli Schwartz Subject: [RFC PATCH 21/21] Introduce support for the Meson build system Message-ID: References: Precedence: bulk X-Mailing-List: git@vger.kernel.org List-Id: List-Subscribe: List-Unsubscribe: MIME-Version: 1.0 Content-Disposition: inline In-Reply-To: Introduce support for the Meson build system, a "modern" meta build system that supports many different plaforms, including Linux, macOS, Windows and BSDs. Meson supports different backends, including Ninja, Xcode and Microsoft Visual Studio. Several common IDEs provide an integration with it. The biggest contender compared to Meson is probably CMake as outlined in our "Documentation/technical/build-systems.txt" file. Based on my own personal experience from working with both build systems extensively I strongly favor Meson over CMake. In my opinion, it feels significantly easier to use with a syntax that feels more like a "real" programming language. The second big reason is that Meson supports Rust natively, which may prove to be important given that the project is likely to pick up Rust as another language eventually. Using Meson is rather straight-forward. An example: ``` # Meson uses out-of-tree builds. You can set up multiple build # directories, how you name them is completely up to you. $ mkdir build $ cd build $ meson setup .. -Dprefix=/tmp/git-installation # Build the project. This also provides several other targets like e.g. `install` or `test`. $ ninja # Meson has been wired up to support execution of our test suites. # Both our unit tests and our integration tests are supported. # Running `meson test` without any arguments will execute all tests, # but the syntax supports globbing to select only some tests. $ meson test 't-*' # Execute single test interactively to allow fordebugging. $ meson test 't0000-*' --interactive --test-args=-ix ``` The build instructions have been successfully tested on the following systems. Tests are mostly passing: - Apple macOS 10.15. - FreeBSD 14.1, except gitweb-based tests. - NixOS 24.11. - Ubuntu 24.04. - Windows 10 with Cygwin, using `-Dperl=disabled -Dpython=disabled`, except for t0052, t0301, t5500, t5572, t5601. - Windows 10 with MinGW64, using `-Dperl=disabled -Dpython=disabled`, except for t7300. It is expected that there will still be rough edges in the current version. If this patch lands the expectation is that it will coexist with our other build systems for a while. Like this, distributions can slowly migrate over to Meson and report any findings they have to us such that we can continue to iterate. A potential cutoff date for other build systems may be Git 3.0. Some notes: - The installed distribution is structured somewhat differently than how it used to be the case. All of our binaries are installed into `$libexec/git-core`, while all binaries part of `$bindir` are now symbolic links pointing to the former. This rule is consistent in itself and thus easier to reason about. - We do not install dashed binaries into `$libexec/git-core` anymore. So there won't e.g. be a symlink for git-add(1). These are not required by modern Git and there isn't really much of a usecase for those anymore. By not installing those symlinks we thus start the deprecation of this layout. - Support for installing documentation has not been wired up yet. This will follow if the project can agree on Meson as build system. - Support for Microsoft Visual Studio has not yet been tested, mostly because I have been fighting with the Windows-based systems for a long while already. This will follow if the project can agree on Meson as build system - Documentation does not yet exist. Same here, it will follow if the project can agree on Meson. - We're targeting a relatively-recent Meson 1.3.0, which has been released November 2023. The only feature we use from that version is `fs.relative_to()`, which we could replace if necessary. If so, we could start to target Meson 1.0.0 and newer, released in December 2022. - The whole build instructions count around 3000 lines, half of which is listing all of our code and test files. Our Makefiles are around 5000 lines of, autoconf adds another 1300 lines. CMake in comparison has only 1200 lines of code, but it avoids listing individual files and does not wire up auto-configuration as extensively as the Meson files do. - I didn't yet port the workaround for the `gettext` package in Homebrew being key-only over. Users have to manually add CFLAGS and LDFLAGS for that library to work around this issue with Homebrew. Signed-off-by: Patrick Steinhardt --- bin-wrappers/meson.build | 28 + contrib/completion/meson.build | 8 + contrib/meson.build | 1 + gitweb/meson.build | 32 + gitweb/static/meson.build | 28 + meson.build | 1567 ++++++++++++++++++++++++++++ meson_options.txt | 67 ++ perl/FromCPAN/Mail/meson.build | 7 + perl/FromCPAN/meson.build | 9 + perl/Git/LoadCPAN/Mail/meson.build | 7 + perl/Git/LoadCPAN/meson.build | 9 + perl/Git/SVN/Memoize/meson.build | 7 + perl/Git/SVN/meson.build | 20 + perl/Git/meson.build | 18 + perl/meson.build | 18 + po/meson.build | 28 + t/helper/meson.build | 91 ++ t/meson.build | 1107 ++++++++++++++++++++ templates/hooks/meson.build | 24 + templates/info/meson.build | 5 + templates/meson.build | 8 + 21 files changed, 3089 insertions(+) create mode 100644 bin-wrappers/meson.build create mode 100644 contrib/completion/meson.build create mode 100644 contrib/meson.build create mode 100644 gitweb/meson.build create mode 100644 gitweb/static/meson.build create mode 100644 meson.build create mode 100644 meson_options.txt create mode 100644 perl/FromCPAN/Mail/meson.build create mode 100644 perl/FromCPAN/meson.build create mode 100644 perl/Git/LoadCPAN/Mail/meson.build create mode 100644 perl/Git/LoadCPAN/meson.build create mode 100644 perl/Git/SVN/Memoize/meson.build create mode 100644 perl/Git/SVN/meson.build create mode 100644 perl/Git/meson.build create mode 100644 perl/meson.build create mode 100644 po/meson.build create mode 100644 t/helper/meson.build create mode 100644 t/meson.build create mode 100644 templates/hooks/meson.build create mode 100644 templates/info/meson.build create mode 100644 templates/meson.build diff --git a/bin-wrappers/meson.build b/bin-wrappers/meson.build new file mode 100644 index 0000000000..6d03a19d7b --- /dev/null +++ b/bin-wrappers/meson.build @@ -0,0 +1,28 @@ +bin_wrappers_config = configuration_data() +foreach key, value : { + 'BUILD_DIR': meson.project_build_root(), + 'MERGE_TOOLS_DIR': meson.project_source_root() / 'mergetools', + 'TEMPLATE_DIR': meson.project_build_root() / 'templates', + 'GIT_TEXTDOMAINDIR': meson.project_build_root() / 'po', + 'GITPERLLIB': meson.project_build_root() / 'perl/lib', +} + # Paths need to be Unix-style without drive prefixes as they get added to the + # PATH variable. And given that drive prefixes contain a colon we'd otherwise + # end up with a broken PATH if we didn't convert them. + if cygpath.found() + value = run_command(cygpath, value, check: true).stdout().strip() + endif + bin_wrappers_config.set(key, value) +endforeach + +foreach executable : bin_wrappers + executable_config = configuration_data() + executable_config.merge_from(bin_wrappers_config) + executable_config.set('PROG', fs.relative_to(executable.full_path(), meson.project_build_root())) + + configure_file( + input: 'wrap-for-bin.sh', + output: fs.stem(executable.full_path()), + configuration: executable_config, + ) +endforeach diff --git a/contrib/completion/meson.build b/contrib/completion/meson.build new file mode 100644 index 0000000000..a9bfe2da31 --- /dev/null +++ b/contrib/completion/meson.build @@ -0,0 +1,8 @@ +foreach script : [ + 'git-completion.bash', + 'git-completion.tcsh', + 'git-completion.zsh', + 'git-prompt.sh' +] + test_dependencies += fs.copyfile(script) +endforeach diff --git a/contrib/meson.build b/contrib/meson.build new file mode 100644 index 0000000000..a7b77b87c2 --- /dev/null +++ b/contrib/meson.build @@ -0,0 +1 @@ +subdir('completion') diff --git a/gitweb/meson.build b/gitweb/meson.build new file mode 100644 index 0000000000..f9c3a76647 --- /dev/null +++ b/gitweb/meson.build @@ -0,0 +1,32 @@ +configure_file( + input: 'gitweb.perl', + output: 'gitweb.cgi', + configuration: { + 'GIT_VERSION': meson.project_version(), + 'GIT_BINDIR': get_option('prefix') / get_option('bindir'), + 'GITWEB_CONFIG': get_option('gitweb_config'), + 'GITWEB_CONFIG_SYSTEM': get_option('gitweb_config_system'), + 'GITWEB_CONFIG_COMMON': get_option('gitweb_config_common'), + 'GITWEB_HOME_LINK_STR': get_option('gitweb_home_link_str'), + 'GITWEB_SITENAME': get_option('gitweb_sitename'), + 'GITWEB_PROJECTROOT': get_option('gitweb_projectroot'), + 'GITWEB_PROJECT_MAXDEPTH': get_option('gitweb_project_maxdepth'), + 'GITWEB_EXPORT_OK': get_option('gitweb_export_ok'), + 'GITWEB_STRICT_EXPORT': get_option('gitweb_strict_export'), + 'GITWEB_BASE_URL': get_option('gitweb_base_url'), + 'GITWEB_LIST': get_option('gitweb_list'), + 'GITWEB_HOMETEXT': get_option('gitweb_hometext'), + 'GITWEB_CSS': get_option('gitweb_css'), + 'GITWEB_LOGO': get_option('gitweb_logo'), + 'GITWEB_FAVICON': get_option('gitweb_favicon'), + 'GITWEB_JS': get_option('gitweb_js'), + 'GITWEB_SITE_HTML_HEAD_STRING': get_option('gitweb_site_html_head_string'), + 'GITWEB_SITE_HEADER': get_option('gitweb_site_header'), + 'GITWEB_SITE_FOOTER': get_option('gitweb_site_footer'), + 'HIGHLIGHT_BIN': get_option('highlight_bin'), + }, + install: true, + install_dir: get_option('datadir') / 'gitweb', +) + +subdir('static') diff --git a/gitweb/static/meson.build b/gitweb/static/meson.build new file mode 100644 index 0000000000..1bdbe70d2d --- /dev/null +++ b/gitweb/static/meson.build @@ -0,0 +1,28 @@ +foreach asset : [ + 'git-favicon.png', + 'git-logo.png', + 'gitweb.css', +] + fs.copyfile(asset, + install: true, + install_dir: get_option('datadir') / 'gitweb/static', + ) +endforeach + +javascript_sources = [ + meson.current_source_dir() / 'js/adjust-timezone.js', + meson.current_source_dir() / 'js/blame_incremental.js', + meson.current_source_dir() / 'js/javascript-detection.js', + meson.current_source_dir() / 'js/lib/common-lib.js', + meson.current_source_dir() / 'js/lib/cookies.js', + meson.current_source_dir() / 'js/lib/datetime.js', +] + +custom_target( + input: javascript_sources, + output: 'gitweb.js', + capture: true, + command: ['cat'] + javascript_sources, + install: true, + install_dir: get_option('datadir') / 'gitweb/static', +) diff --git a/meson.build b/meson.build new file mode 100644 index 0000000000..b6f875daba --- /dev/null +++ b/meson.build @@ -0,0 +1,1567 @@ +project('git', 'c', + version: run_command('GIT-VERSION-GEN', check: true).stdout().strip(), + meson_version: '>=1.3.0', +) + +fs = import('fs') + +compiler = meson.get_compiler('c') + +cygpath = find_program('cygpath', required: false) +shell = find_program('sh') +tar = find_program('tar') +diff = find_program('diff') + +libgit_sources = [ + 'abspath.c', + 'add-interactive.c', + 'add-patch.c', + 'advice.c', + 'alias.c', + 'alloc.c', + 'apply.c', + 'archive-tar.c', + 'archive-zip.c', + 'archive.c', + 'attr.c', + 'base85.c', + 'bisect.c', + 'blame.c', + 'blob.c', + 'bloom.c', + 'branch.c', + 'bulk-checkin.c', + 'bundle-uri.c', + 'bundle.c', + 'cache-tree.c', + 'cbtree.c', + 'chdir-notify.c', + 'checkout.c', + 'chunk-format.c', + 'color.c', + 'column.c', + 'combine-diff.c', + 'commit-graph.c', + 'commit-reach.c', + 'commit.c', + 'compat/nonblock.c', + 'compat/obstack.c', + 'compat/terminal.c', + 'compat/zlib-uncompress2.c', + 'config.c', + 'connect.c', + 'connected.c', + 'convert.c', + 'copy.c', + 'credential.c', + 'csum-file.c', + 'ctype.c', + 'date.c', + 'decorate.c', + 'delta-islands.c', + 'diagnose.c', + 'diff-delta.c', + 'diff-merges.c', + 'diff-lib.c', + 'diff-no-index.c', + 'diff.c', + 'diffcore-break.c', + 'diffcore-delta.c', + 'diffcore-order.c', + 'diffcore-pickaxe.c', + 'diffcore-rename.c', + 'diffcore-rotate.c', + 'dir-iterator.c', + 'dir.c', + 'editor.c', + 'entry.c', + 'environment.c', + 'ewah/bitmap.c', + 'ewah/ewah_bitmap.c', + 'ewah/ewah_io.c', + 'ewah/ewah_rlw.c', + 'exec-cmd.c', + 'fetch-negotiator.c', + 'fetch-pack.c', + 'fmt-merge-msg.c', + 'fsck.c', + 'fsmonitor.c', + 'fsmonitor-ipc.c', + 'fsmonitor-settings.c', + 'gettext.c', + 'git-zlib.c', + 'gpg-interface.c', + 'graph.c', + 'grep.c', + 'hash-lookup.c', + 'hashmap.c', + 'help.c', + 'hex.c', + 'hex-ll.c', + 'hook.c', + 'ident.c', + 'json-writer.c', + 'kwset.c', + 'levenshtein.c', + 'line-log.c', + 'line-range.c', + 'linear-assignment.c', + 'list-objects-filter-options.c', + 'list-objects-filter.c', + 'list-objects.c', + 'lockfile.c', + 'log-tree.c', + 'loose.c', + 'ls-refs.c', + 'mailinfo.c', + 'mailmap.c', + 'match-trees.c', + 'mem-pool.c', + 'merge-blobs.c', + 'merge-ll.c', + 'merge-ort.c', + 'merge-ort-wrappers.c', + 'merge-recursive.c', + 'merge.c', + 'midx.c', + 'midx-write.c', + 'name-hash.c', + 'negotiator/default.c', + 'negotiator/noop.c', + 'negotiator/skipping.c', + 'notes-cache.c', + 'notes-merge.c', + 'notes-utils.c', + 'notes.c', + 'object-file-convert.c', + 'object-file.c', + 'object-name.c', + 'object.c', + 'oid-array.c', + 'oidmap.c', + 'oidset.c', + 'oidtree.c', + 'pack-bitmap-write.c', + 'pack-bitmap.c', + 'pack-check.c', + 'pack-mtimes.c', + 'pack-objects.c', + 'pack-revindex.c', + 'pack-write.c', + 'packfile.c', + 'pager.c', + 'parallel-checkout.c', + 'parse.c', + 'parse-options-cb.c', + 'parse-options.c', + 'patch-delta.c', + 'patch-ids.c', + 'path.c', + 'pathspec.c', + 'pkt-line.c', + 'preload-index.c', + 'pretty.c', + 'prio-queue.c', + 'progress.c', + 'promisor-remote.c', + 'prompt.c', + 'protocol.c', + 'protocol-caps.c', + 'prune-packed.c', + 'pseudo-merge.c', + 'quote.c', + 'range-diff.c', + 'reachable.c', + 'read-cache.c', + 'rebase-interactive.c', + 'rebase.c', + 'ref-filter.c', + 'reflog-walk.c', + 'reflog.c', + 'refs.c', + 'refs/debug.c', + 'refs/files-backend.c', + 'refs/reftable-backend.c', + 'refs/iterator.c', + 'refs/packed-backend.c', + 'refs/ref-cache.c', + 'refspec.c', + 'reftable/basics.c', + 'reftable/error.c', + 'reftable/block.c', + 'reftable/blocksource.c', + 'reftable/iter.c', + 'reftable/publicbasics.c', + 'reftable/merged.c', + 'reftable/pq.c', + 'reftable/reader.c', + 'reftable/record.c', + 'reftable/stack.c', + 'reftable/tree.c', + 'reftable/writer.c', + 'remote.c', + 'replace-object.c', + 'repo-settings.c', + 'repository.c', + 'rerere.c', + 'reset.c', + 'resolve-undo.c', + 'revision.c', + 'run-command.c', + 'send-pack.c', + 'sequencer.c', + 'serve.c', + 'server-info.c', + 'setup.c', + 'shallow.c', + 'sideband.c', + 'sigchain.c', + 'sparse-index.c', + 'split-index.c', + 'stable-qsort.c', + 'statinfo.c', + 'strbuf.c', + 'streaming.c', + 'string-list.c', + 'strmap.c', + 'strvec.c', + 'sub-process.c', + 'submodule-config.c', + 'submodule.c', + 'symlinks.c', + 'tag.c', + 'tempfile.c', + 'thread-utils.c', + 'tmp-objdir.c', + 'trace.c', + 'trace2.c', + 'trace2/tr2_cfg.c', + 'trace2/tr2_cmd_name.c', + 'trace2/tr2_ctr.c', + 'trace2/tr2_dst.c', + 'trace2/tr2_sid.c', + 'trace2/tr2_sysenv.c', + 'trace2/tr2_tbuf.c', + 'trace2/tr2_tgt_event.c', + 'trace2/tr2_tgt_normal.c', + 'trace2/tr2_tgt_perf.c', + 'trace2/tr2_tls.c', + 'trace2/tr2_tmr.c', + 'trailer.c', + 'transport-helper.c', + 'transport.c', + 'tree-diff.c', + 'tree-walk.c', + 'tree.c', + 'unpack-trees.c', + 'upload-pack.c', + 'url.c', + 'urlmatch.c', + 'usage.c', + 'userdiff.c', + 'utf8.c', + 'varint.c', + 'versioncmp.c', + 'walker.c', + 'wildmatch.c', + 'worktree.c', + 'wrapper.c', + 'write-or-die.c', + 'ws.c', + 'wt-status.c', + 'xdiff-interface.c', + 'xdiff/xdiffi.c', + 'xdiff/xemit.c', + 'xdiff/xhistogram.c', + 'xdiff/xmerge.c', + 'xdiff/xpatience.c', + 'xdiff/xprepare.c', + 'xdiff/xutils.c', +] + +builtin_sources = [ + 'builtin/add.c', + 'builtin/am.c', + 'builtin/annotate.c', + 'builtin/apply.c', + 'builtin/archive.c', + 'builtin/bisect.c', + 'builtin/blame.c', + 'builtin/branch.c', + 'builtin/bugreport.c', + 'builtin/bundle.c', + 'builtin/cat-file.c', + 'builtin/check-attr.c', + 'builtin/check-ignore.c', + 'builtin/check-mailmap.c', + 'builtin/check-ref-format.c', + 'builtin/checkout--worker.c', + 'builtin/checkout-index.c', + 'builtin/checkout.c', + 'builtin/clean.c', + 'builtin/clone.c', + 'builtin/column.c', + 'builtin/commit-graph.c', + 'builtin/commit-tree.c', + 'builtin/commit.c', + 'builtin/config.c', + 'builtin/count-objects.c', + 'builtin/credential-cache--daemon.c', + 'builtin/credential-cache.c', + 'builtin/credential-store.c', + 'builtin/credential.c', + 'builtin/describe.c', + 'builtin/diagnose.c', + 'builtin/diff-files.c', + 'builtin/diff-index.c', + 'builtin/diff-tree.c', + 'builtin/diff.c', + 'builtin/difftool.c', + 'builtin/fast-export.c', + 'builtin/fast-import.c', + 'builtin/fetch-pack.c', + 'builtin/fetch.c', + 'builtin/fmt-merge-msg.c', + 'builtin/for-each-ref.c', + 'builtin/for-each-repo.c', + 'builtin/fsck.c', + 'builtin/fsmonitor--daemon.c', + 'builtin/gc.c', + 'builtin/get-tar-commit-id.c', + 'builtin/grep.c', + 'builtin/hash-object.c', + 'builtin/help.c', + 'builtin/hook.c', + 'builtin/index-pack.c', + 'builtin/init-db.c', + 'builtin/interpret-trailers.c', + 'builtin/log.c', + 'builtin/ls-files.c', + 'builtin/ls-remote.c', + 'builtin/ls-tree.c', + 'builtin/mailinfo.c', + 'builtin/mailsplit.c', + 'builtin/merge-base.c', + 'builtin/merge-file.c', + 'builtin/merge-index.c', + 'builtin/merge-ours.c', + 'builtin/merge-recursive.c', + 'builtin/merge-tree.c', + 'builtin/merge.c', + 'builtin/mktag.c', + 'builtin/mktree.c', + 'builtin/multi-pack-index.c', + 'builtin/mv.c', + 'builtin/name-rev.c', + 'builtin/notes.c', + 'builtin/pack-objects.c', + 'builtin/pack-redundant.c', + 'builtin/pack-refs.c', + 'builtin/patch-id.c', + 'builtin/prune-packed.c', + 'builtin/prune.c', + 'builtin/pull.c', + 'builtin/push.c', + 'builtin/range-diff.c', + 'builtin/read-tree.c', + 'builtin/rebase.c', + 'builtin/receive-pack.c', + 'builtin/reflog.c', + 'builtin/refs.c', + 'builtin/remote-ext.c', + 'builtin/remote-fd.c', + 'builtin/remote.c', + 'builtin/repack.c', + 'builtin/replace.c', + 'builtin/replay.c', + 'builtin/rerere.c', + 'builtin/reset.c', + 'builtin/rev-list.c', + 'builtin/rev-parse.c', + 'builtin/revert.c', + 'builtin/rm.c', + 'builtin/send-pack.c', + 'builtin/shortlog.c', + 'builtin/show-branch.c', + 'builtin/show-index.c', + 'builtin/show-ref.c', + 'builtin/sparse-checkout.c', + 'builtin/stash.c', + 'builtin/stripspace.c', + 'builtin/submodule--helper.c', + 'builtin/symbolic-ref.c', + 'builtin/tag.c', + 'builtin/unpack-file.c', + 'builtin/unpack-objects.c', + 'builtin/update-index.c', + 'builtin/update-ref.c', + 'builtin/update-server-info.c', + 'builtin/upload-archive.c', + 'builtin/upload-pack.c', + 'builtin/var.c', + 'builtin/verify-commit.c', + 'builtin/verify-pack.c', + 'builtin/verify-tag.c', + 'builtin/worktree.c', + 'builtin/write-tree.c', +] + +libgit_sources += custom_target( + 'command-list.h', + input: 'command-list.txt', + output: 'command-list.h', + command: [shell, meson.current_source_dir() + '/generate-cmdlist.sh', meson.current_source_dir(), '@OUTPUT@'], +) + +libgit_sources += custom_target( + 'config-list.h', + output: 'config-list.h', + command: [ + shell, + meson.current_source_dir() + '/generate-configlist.sh', + meson.current_source_dir(), + '@OUTPUT@', + ], +) + +libgit_sources += custom_target( + 'hook-list.h', + input: 'Documentation/githooks.txt', + output: 'hook-list.h', + command: [ + shell, + meson.current_source_dir() + '/generate-hooklist.sh', + meson.current_source_dir(), + '@OUTPUT@', + ], +) + +# This contains the variables for GIT-BUILD-OPTIONS, which we use to propagate +# build options to our tests. +build_options_config = configuration_data() +build_options_config.set('GIT_INTEROP_MAKE_OPTS', '') +build_options_config.set('GIT_PERF_LARGE_REPO', '') +build_options_config.set('GIT_PERF_MAKE_COMMAND', '') +build_options_config.set('GIT_PERF_MAKE_OPTS', '') +build_options_config.set('GIT_PERF_REPEAT_COUNT', '') +build_options_config.set('GIT_PERF_REPO', '') +build_options_config.set('GIT_TEST_CMP_USE_COPIED_CONTEXT', '') +build_options_config.set('GIT_TEST_INDEX_VERSION', '') +build_options_config.set('GIT_TEST_OPTS', '') +build_options_config.set('GIT_TEST_PERL_FATAL_WARNINGS', '') +build_options_config.set('GIT_TEST_UTF8_LOCALE', '') +build_options_config.set('SANITIZE_ADDRESS', '') +build_options_config.set('SANITIZE_LEAK', '') + +test_output_directory = get_option('test_output_directory') +if test_output_directory == '' + test_output_directory = meson.project_build_root() / 'test-output' +endif + +# These variables are used for building libgit.a. +libgit_c_args = [ + '-DBINDIR="' + get_option('bindir') + '"', + '-DDEFAULT_EDITOR="' + get_option('default_editor') + '"', + '-DDEFAULT_GIT_TEMPLATE_DIR="' + get_option('datadir') / 'git-core/templates' + '"', + '-DDEFAULT_HELP_FORMAT="' + get_option('default_help_format') + '"', + '-DDEFAULT_PAGER="' + get_option('default_pager') + '"', + '-DETC_GITATTRIBUTES="' + get_option('gitattributes') + '"', + '-DETC_GITCONFIG="' + get_option('gitconfig') + '"', + '-DFALLBACK_RUNTIME_PREFIX="' + get_option('prefix') + '"', + '-DGIT_EXEC_PATH="' + get_option('prefix') / get_option('libexecdir') / 'git-core"', + '-DGIT_HOST_CPU="' + host_machine.cpu_family() + '"', + '-DGIT_HTML_PATH="' + get_option('datadir') / 'doc/git-doc"', + '-DGIT_INFO_PATH="' + get_option('infodir') + '"', + '-DGIT_LOCALE_PATH="' + get_option('localedir') + '"', + '-DGIT_MAN_PATH="' + get_option('mandir') + '"', + '-DPAGER_ENV="' + get_option('pager_environment') + '"', + '-DSHELL_PATH="' + fs.as_posix(shell.full_path()) + '"', +] +libgit_include_directories = [ '.' ] +libgit_dependencies = [ ] + +executable_suffix = '' +if host_machine.system() == 'cygwin' or host_machine.system() == 'windows' + executable_suffix = '.exe' + libgit_c_args += '-DSTRIP_EXTENSION="' + executable_suffix + '"' +endif +build_options_config.set_quoted('X', executable_suffix) + +python = import('python').find_installation('python3', required: get_option('python')) +if python.found() + build_options_config.set('NO_PYTHON', '') +else + libgit_c_args += '-DNO_PYTHON' + build_options_config.set('NO_PYTHON', '1') +endif + +# Perl is used for two different things: our test harness and to provide some +# features. It is optional if you want to neither execute tests nor use any of +# these optional features. +perl_required = get_option('perl') +if get_option('tests') + perl_required = true +endif + +# Note that we only set NO_PERL if the Perl features were disabled by the user. +# It may not be set when we have found Perl, but only use it to run tests. +perl = find_program('perl', version: '>=5.8.1', required: perl_required) +perl_features_enabled = perl.found() and get_option('perl').allowed() +if perl_features_enabled + build_options_config.set('NO_PERL', '') +else + libgit_c_args += '-DNO_PERL' + build_options_config.set('NO_PERL', '1') +endif + +zlib = dependency('zlib') +libgit_dependencies += zlib +if not compiler.has_function('deflateBound', + prefix: '#include ', + dependencies: zlib, +) + libgit_c_args += '-DNO_DEFLATE_BOUND' +endif + +threads = dependency('threads', required: false) +if threads.found() + libgit_dependencies += threads + build_options_config.set('NO_PTHREADS', '') +else + libgit_c_args += '-DNO_PTHREADS' + build_options_config.set('NO_PTHREADS', '1') +endif + +intl = dependency('intl', required: get_option('gettext')) +if intl.found() + libgit_dependencies += intl + build_options_config.set('NO_GETTEXT', '') +else + libgit_c_args += '-DNO_GETTEXT' + build_options_config.set('NO_GETTEXT', '1') +endif + +iconv = dependency('iconv', required: get_option('iconv')) +if iconv.found() + libgit_dependencies += iconv + + have_old_iconv = false + if not compiler.compiles(''' + #include + + extern size_t iconv(iconv_t cd, + char **inbuf, size_t *inbytesleft, + char **outbuf, size_t *outbytesleft); + ''', name: 'old iconv interface', dependencies: [iconv]) + libgit_c_args += '-DOLD_ICONV' + have_old_iconv = true + endif + + iconv_omits_bom_source = '''# + #include + + int main(int argc, const char **argv) + { + ''' + if have_old_iconv + iconv_omits_bom_source += ''' + typedef const char *iconv_ibp; + ''' + else + iconv_omits_bom_source += ''' + typedef char *iconv_ibp; + ''' + endif + iconv_omits_bom_source += ''' + int v; + iconv_t conv; + char in[] = "a"; iconv_ibp pin = in; + char out[20] = ""; char *pout = out; + size_t isz = sizeof in; + size_t osz = sizeof out; + + conv = iconv_open("UTF-16", "UTF-8"); + iconv(conv, &pin, &isz, &pout, &osz); + iconv_close(conv); + v = (unsigned char)(out[0]) + (unsigned char)(out[1]); + return v != 0xfe + 0xff; + } + ''' + + if compiler.run(iconv_omits_bom_source, + dependencies: iconv, + name: 'iconv omits BOM', + ).returncode() != 0 + libgit_c_args += '-DICONV_OMITS_BOM' + endif +else + libgit_c_args += '-DNO_ICONV' +endif + +pcre2 = dependency('libpcre2-8', required: get_option('pcre2')) +if pcre2.found() + libgit_dependencies += pcre2 + libgit_c_args += '-DUSE_LIBPCRE2' + build_options_config.set('USE_LIBPCRE2', '1') +else + build_options_config.set('USE_LIBPCRE2', '') +endif + +curl = dependency('libcurl', version: '>=7.21.3', required: get_option('curl')) +use_curl_for_imap_send = false +if curl.found() + if curl.version().version_compare('>=7.34.0') + libgit_c_args += '-DUSE_CURL_FOR_IMAP_SEND' + use_curl_for_imap_send = true + endif + + libgit_dependencies += curl + libgit_c_args += '-DCURL_DISABLE_TYPECHECK' + build_options_config.set('NO_CURL', '') +else + libgit_c_args += '-DNO_CURL' + build_options_config.set('NO_CURL', '1') +endif + +expat = dependency('expat', required: get_option('expat')) +if expat.found() + libgit_dependencies += expat + + if expat.version().version_compare('<=1.2') + libgit_c_args += '-DEXPAT_NEEDS_XMLPARSE_H' + endif + build_options_config.set('NO_EXPAT', '') +else + libgit_c_args += '-DNO_EXPAT' + build_options_config.set('NO_EXPAT', '1') +endif + +if not compiler.has_header('sys/select.h') + libgit_c_args += '-DNO_SYS_SELECT_H' +endif + +has_poll_h = compiler.has_header('poll.h') +if not has_poll_h + libgit_c_args += '-DNO_POLL_H' +endif + +has_sys_poll_h = compiler.has_header('sys/poll.h') +if not has_sys_poll_h + libgit_c_args += '-DNO_SYS_POLL_H' +endif + +if not has_poll_h and not has_sys_poll_h + libgit_c_args += '-DNO_POLL' + libgit_sources += 'compat/poll/poll.c' + libgit_include_directories += 'compat/poll' +endif + +if not compiler.has_header('inttypes.h') + libgit_c_args += '-DNO_INTTYPES_H' +endif + +if compiler.has_header('libcharset.h') + libcharset = compiler.find_library('charset') + + if compiler.has_function('locale_charset', + prefix: '#include ', + dependencies: iconv, + ) + libgit_c_args += '-DHAVE_LIBCHARSET_H' + elif compiler.has_function('locale_charset', + prefix: '#include ', + dependencies: libcharset, + ) + libgit_c_args += '-DHAVE_LIBCHARSET_H' + endif +endif + +if compiler.has_header('alloca.h') + libgit_c_args += '-DHAVE_ALLOCA_H' +endif + +if compiler.has_header('sys/sysinfo.h') + libgit_c_args += '-DHAVE_SYSINFO' +endif + +# Windows has libgen.h and a basename implementation, but we still need our own +# implementation to threat things like drive prefixes specially. +if host_machine.system() == 'windows' or not compiler.has_header('libgen.h') + libgit_c_args += '-DNO_LIBGEN_H' + libgit_sources += 'compat/basename.c' +endif + +if compiler.has_header('paths.h') + libgit_c_args += '-DHAVE_PATHS_H' +endif + +if compiler.has_header('strings.h') + libgit_c_args += '-DHAVE_STRINGS_H' +endif + +networking_dependencies = [ ] +winsock = compiler.find_library('ws2_32', required: false) +if winsock.found() + networking_dependencies += winsock +endif +libresolv = compiler.find_library('resolv', required: false) +if libresolv.found() + networking_dependencies += libresolv +endif +libgit_dependencies += networking_dependencies + +foreach symbol : ['inet_ntop', 'inet_pton', 'strerror'] + if not compiler.has_function(symbol, dependencies: networking_dependencies) + libgit_c_args += '-DNO_' + symbol.to_upper() + endif +endforeach + +has_ipv6 = compiler.has_function('getaddrinfo', dependencies: networking_dependencies) +if not has_ipv6 + libgit_c_args += '-DNO_IPV6' +endif + +if not compiler.compiles(''' + #ifdef _WIN32 + # include + #else + # include + # include + #endif + + void func(void) + { + struct sockaddr_storage x; + } +''', name: 'struct sockaddr_storage') + if has_ipv6 + libgit_c_args += '-Dsockaddr_storage=sockaddr_in6' + else + libgit_c_args += '-Dsockaddr_storage=sockaddr_in' + endif +endif + +if compiler.has_function('socket', dependencies: networking_dependencies) + libgit_sources += [ + 'unix-socket.c', + 'unix-stream-server.c', + ] + build_options_config.set('NO_UNIX_SOCKETS', '') +else + libgit_c_args += '-DNO_UNIX_SOCKETS' + build_options_config.set('NO_UNIX_SOCKETS', '1') +endif + +if not compiler.has_function('pread') + libgit_c_args += '-DNO_PREAD' + libgit_sources += 'compat/pread.c' +endif + +if host_machine.system() == 'darwin' + libgit_sources += 'compat/precompose_utf8.c' + libgit_c_args += '-DPRECOMPOSE_UNICODE' + libgit_c_args += '-DPROTECT_HFS_DEFAULT' +endif + +# Configure general compatibility wrappers. +if host_machine.system() == 'cygwin' + libgit_sources += [ + 'compat/win32/path-utils.c', + ] +elif host_machine.system() == 'windows' + libgit_sources += [ + 'compat/mingw.c', + 'compat/winansi.c', + 'compat/win32/flush.c', + 'compat/win32/path-utils.c', + 'compat/win32/pthread.c', + 'compat/win32/syslog.c', + 'compat/win32/trace2_win32_process_info.c', + 'compat/win32/dirent.c', + 'compat/win32mmap.c', + 'compat/nedmalloc/nedmalloc.c', + ] + + libgit_c_args += [ + '-DDETECT_MSYS_TTY', + '-DENSURE_MSYSTEM_IS_SET', + '-DNATIVE_CRLF', + '-DNOGDI', + '-DNO_POSIX_GOODIES', + '-DWIN32', + '-D_CONSOLE', + '-D_CONSOLE_DETECT_MSYS_TTY', + '-D__USE_MINGW_ANSI_STDIO=0', + ] + + libgit_dependencies += compiler.find_library('ntdll') + libgit_include_directories += 'compat/win32' +endif + +if host_machine.system() == 'linux' + libgit_sources += 'compat/linux/procinfo.c' +else + libgit_sources += 'compat/stub/procinfo.c' +endif + +if host_machine.system() == 'cygwin' or host_machine.system() == 'windows' + libgit_c_args += [ + '-DUNRELIABLE_FSTAT', + '-DMMAP_PREVENTS_DELETE', + '-DOBJECT_CREATION_MODE=1', + ] +endif + +# Configure the simple-ipc subsystem required fro the fsmonitor. +if host_machine.system() == 'windows' + libgit_sources += [ + 'compat/simple-ipc/ipc-shared.c', + 'compat/simple-ipc/ipc-win32.c', + ] + libgit_c_args += '-DSUPPORTS_SIMPLE_IPC' +else + libgit_sources += [ + 'compat/simple-ipc/ipc-shared.c', + 'compat/simple-ipc/ipc-unix-socket.c', + ] + libgit_c_args += '-DSUPPORTS_SIMPLE_IPC' +endif + +fsmonitor_backend = '' +if host_machine.system() == 'windows' + fsmonitor_backend = 'win32' +elif host_machine.system() == 'darwin' + fsmonitor_backend = 'darwin' + libgit_dependencies += dependency('CoreServices') +endif +if fsmonitor_backend != '' + libgit_c_args += '-DHAVE_FSMONITOR_DAEMON_BACKEND' + libgit_c_args += '-DHAVE_FSMONITOR_OS_SETTINGS' + + libgit_sources += [ + 'compat/fsmonitor/fsm-health-' + fsmonitor_backend + '.c', + 'compat/fsmonitor/fsm-ipc-' + fsmonitor_backend + '.c', + 'compat/fsmonitor/fsm-listen-' + fsmonitor_backend + '.c', + 'compat/fsmonitor/fsm-path-utils-' + fsmonitor_backend + '.c', + 'compat/fsmonitor/fsm-settings-' + fsmonitor_backend + '.c', + ] +endif +build_options_config.set_quoted('FSMONITOR_DAEMON_BACKEND', fsmonitor_backend) +build_options_config.set_quoted('FSMONITOR_OS_SETTINGS', fsmonitor_backend) + +if compiler.get_define('REG_STARTEND', prefix: '#include ') != '' + build_options_config.set('NO_REGEX', '') +else + libgit_c_args += [ + '-DNO_REGEX', + '-DGAWK', + '-DNO_MBSUPPORT', + ] + build_options_config.set('NO_REGEX', '1') + libgit_sources += 'compat/regex/regex.c' + libgit_include_directories += 'compat/regex' +endif +if compiler.get_define('REG_ENHANCED', prefix: '#include ') != '' + libgit_c_args += '-DUSE_ENHANCED_BASIC_REGULAR_EXPRESSIONS' + libgit_sources += 'compat/regcomp_enhanced.c' +endif + +# setitimer and friends are provided by compat/mingw.c. +if host_machine.system() != 'windows' + if not compiler.compiles(''' + #include + void func(void) + { + struct itimerval value; + } + ''', name: 'struct itimerval') + libgit_c_args += '-DNO_STRUCT_ITIMERVAL' + libgit_c_args += '-DNO_SETITIMER' + elif not compiler.has_function('setitimer') + libgit_c_args += '-DNO_SETITIMER' + endif +endif + +if compiler.has_member('struct stat', 'st_mtimespec.tv_nsec', prefix: '#include ') + libgit_c_args += '-DUSE_ST_TIMESPEC' +elif not compiler.has_member('struct stat', 'st_mtim.tv_nsec', prefix: '#include ') + libgit_c_args += '-DNO_NSEC' +endif + +if not compiler.has_member('struct stat', 'st_blocks', prefix: '#include ') + libgit_c_args += '-DNO_ST_BLOCKS_IN_STRUCT_STAT' +endif + +if not compiler.has_member('struct dirent', 'd_type', prefix: '#include ') + libgit_c_args += '-DNO_D_TYPE_IN_DIRENT' +endif + +if not compiler.has_member('struct passwd', 'pw_gecos', prefix: '#include ') + libgit_c_args += '-DNO_GECOS_IN_PWENT' +endif + +if compiler.has_function('sync_file_range') + libgit_c_args += '-DHAVE_SYNC_FILE_RANGE' +endif + +if not compiler.has_function('strcasestr') + libgit_c_args += '-DNO_STRCASESTR' + libgit_sources += 'compat/strcasestr.c' +endif + +if not compiler.has_function('memmem') + libgit_c_args += '-DNO_MEMMEM' + libgit_sources += 'compat/memmem.c' +endif + +if not compiler.has_function('strlcpy') + libgit_c_args += '-DNO_STRLCPY' + libgit_sources += 'compat/strlcpy.c' +endif + +if not compiler.has_function('strdup') + libgit_c_args += '-DOVERRIDE_STRDUP' + libgit_sources += 'compat/strdup.c' +endif + +if not compiler.has_function('strtoumax') + libgit_c_args += '-DNO_STRTOUMAX' + libgit_sources += [ + 'compat/strtoumax.c', + 'compat/strtoimax.c', + ] +endif + +if not compiler.has_function('strtoull') + libgit_c_args += '-DNO_STRTOULL' +endif + +if not compiler.has_function('setenv') + libgit_c_args += '-DNO_SETENV' + libgit_sources += 'compat/setenv.c' +endif + +if not compiler.has_function('qsort') + libgit_c_args += '-DINTERNAL_QSORT' +endif +libgit_sources += 'compat/qsort_s.c' + +# unsetenv is provided by compat/mingw.c. +if host_machine.system() != 'windows' and not compiler.has_function('unsetenv') + libgit_c_args += '-DNO_UNSETENV' + libgit_sources += 'compat/unsetenv.c' +endif + +if not compiler.has_function('mkdtemp') + libgit_c_args += '-DNO_MKDTEMP' + libgit_sources += 'compat/mkdtemp.c' +endif + +if not compiler.has_function('initgroups') + libgit_c_args += '-DNO_INITGROUPS' +endif + +if compiler.has_function('getdelim') + libgit_c_args += '-DHAVE_GETDELIM' +endif + +if host_machine.system() == 'windows' + libgit_c_args += '-DUSE_WIN32_MMAP' +elif not compiler.has_function('mmap') + libgit_c_args += '-DNO_MMAP' + libgit_sources += 'compat/mmap.c' +endif + +if compiler.has_function('clock_gettime') + libgit_c_args += '-DHAVE_CLOCK_GETTIME' +endif + +if compiler.compiles(''' + #include + + void func(void) + { + clockid_t id = CLOCK_MONOTONIC; + } +''', name: 'monotonic clock') + libgit_c_args += '-DHAVE_CLOCK_MONOTONIC' +endif + +if compiler.compiles(''' + #include + + void func(void) + { + uintmax_t x = 0; + } +''', name: 'uintmax_t') + libgit_c_args += '-DNO_UINTMAX_T' +endif + +has_bsd_sysctl = false +if compiler.has_header('sys/sysctl.h') + if compiler.compiles(''' + #include + #include + + void func(void) + { + int val, mib[2] = { 0 }; + size_t len = sizeof(val); + sysctl(mib, 2, &val, &len, NULL, 0); + } + ''', name: 'BSD sysctl') + libgit_c_args += '-DHAVE_BSD_SYSCTL' + has_bsd_sysctl = true + endif +endif + +if compiler.run(''' + #include + + int main(int argc, const char **argv) + { + FILE *f = fopen(".", "r"); + return f ? 0 : 1; + } +''', name: 'fread reads directories').returncode() == 0 + libgit_c_args += '-DFREAD_READS_DIRECTORIES' + libgit_sources += 'compat/fopen.c' +endif + +if not meson.is_cross_build() and fs.exists('/dev/tty') + libgit_c_args += '-DHAVE_DEV_TTY' +endif + +if get_option('openssl').enabled() and get_option('CommonCrypto').enabled() + error('Can only use one SSL backend') +endif + +security_framework = dependency('Security', required: get_option('CommonCrypto').disable_auto_if(host_machine.system() != 'darwin')) +core_foundation_framework = dependency('CoreFoundation', required: security_framework.found()) +if security_framework.found() + libgit_dependencies += security_framework + libgit_dependencies += core_foundation_framework + libgit_c_args += '-DAPPLE_COMMON_CRYPTO' +endif + +# OpenSSL is required when requested via the 'openssl' feature or via one of +# the SHA1/SHA256 backends. +openssl_required = get_option('openssl').disable_auto_if(security_framework.found()) +if get_option('sha1_backend') == 'openssl' or get_option('sha256_backend') == 'openssl' + openssl_required = true +endif + +openssl = dependency('openssl', required: openssl_required) +if openssl.found() + libgit_dependencies += openssl +endif + +# We may not want to use OpenSSL for anything but our SHA1/SHA256 backends, so +# we cannot just set NO_OPENSSL based on whether or not the library was found. +if not openssl.found() or get_option('openssl').disabled() + libgit_c_args += '-DNO_OPENSSL' +endif + +sha1_backend = get_option('sha1_backend') +if sha1_backend == 'sha1dc' + libgit_c_args += '-DSHA1_DC' + libgit_c_args += '-DSHA1DC_NO_STANDARD_INCLUDES=1' + libgit_c_args += '-DSHA1DC_INIT_SAFE_HASH_DEFAULT=0' + libgit_c_args += '-DSHA1DC_CUSTOM_INCLUDE_SHA1_C="git-compat-util.h"' + libgit_c_args += '-DSHA1DC_CUSTOM_INCLUDE_UBC_CHECK_C="git-compat-util.h"' + + libgit_sources += [ + 'sha1dc_git.c', + 'sha1dc/sha1.c', + 'sha1dc/ubc_check.c', + ] +elif sha1_backend == 'common-crypto' + libgit_c_args += '-DCOMMON_DIGEST_FOR_OPENSSL' + libgit_c_args += '-DSHA1_APPLE' + libgit_c_args += '-DSHA1_MAX_BLOCK_SIZE=1024L*1024L*1024L' +elif sha1_backend == 'openssl' + if not openssl.found() + openssl = dependency('openssl', required: true) + endif + + libgit_c_args += '-DSHA1_OPENSSL' + # Apple CommonCrypto requires chunking +elif sha1_backend == 'block' + libgit_c_args += '-DSHA1_BLK' + libgit_sources += 'block-sha1/sha1.c' +else + error('Unhandled SHA1 backend ' + sha1_backend) +endif + +sha256_backend = get_option('sha256_backend') +if sha256_backend == 'openssl' + libgit_c_args += '-DSHA256_OPENSSL' +elif sha256_backend == 'nettle' + nettle = dependency('nettle') + libgit_dependencies += nettle + libgit_c_args += '-DSHA256_NETTLE' +elif sha256_backend == 'gcrypt' + gcrypt = dependency('gcrypt') + libgit_dependencies += gcrypt + libgit_c_args += '-DSHA256_GCRYPT' +elif sha256_backend == 'block' + libgit_c_args += '-DSHA256_BLK' + libgit_sources += 'sha256/block/sha256.c' +else + error('Unhandled SHA256 backend ' + sha256_backend) +endif + +if compiler.has_header_symbol('stdlib.h', 'arc4random_buf') + libgit_c_args += '-DHAVE_ARC4RANDOM' +elif compiler.has_header_symbol('bsd/stdlib.h', 'arc4random_buf') + libgit_c_args += '-DHAVE_ARC4RANDOM_BSD' +elif compiler.has_function('getrandom', prefix: '#include ') + libgit_c_args += '-DHAVE_GETRANDOM' +elif compiler.has_function('getentropy', prefix: '#include ') + libgit_c_args += '-DHAVE_GETENTROPY' +elif compiler.has_function('RtlGenRandom', prefix: '#include \n#include ') + libgit_c_args += '-DHAVE_RTLGENRANDOM' +elif openssl.found() + libgit_c_args += '-DHAVE_OPENSSL_CSPRNG' +endif + +if get_option('runtime_prefix') + libgit_c_args += '-DRUNTIME_PREFIX' + build_options_config.set('RUNTIME_PREFIX', '1') + + if compiler.has_header('mach-o/dyld.h') + libgit_c_args += '-DHAVE_NS_GET_EXECUTABLE_PATH' + endif + + if has_bsd_sysctl and compiler.compiles(''' + #include + + void func(void) + { + KERN_PROC_PATHNAME; KERN_PROC; + } + ''', name: 'BSD KERN_PROC_PATHNAME') + libgit_c_args += '-DHAVE_NS_GET_EXECUTABLE_PATH' + endif + + if host_machine.system() == 'linux' + libgit_c_args += '-DPROCFS_EXECUTABLE_PATH="/proc/self/exe' + '"' + elif host_machine.system() == 'openbsd' + libgit_c_args += '-DPROCFS_EXECUTABLE_PATH="' + '/proc/curproc/file' + '"' + elif host_machine.system() == 'netbsd' + libgit_c_args += '-DPROCFS_EXECUTABLE_PATH="' + '/proc/curproc/exe' + '"' + endif + + if host_machine.system() == 'windows' and compiler.compiles(''' + #include + + void func(void) + { + _wpgmptr; + } + ''', name: 'Win32 _wpgmptr') + libgit_c_args += '-DHAVE_WPGMPTR' + endif +else + build_options_config.set('RUNTIME_PREFIX', '') +endif + +foreach key, value : { + 'DIFF': diff.full_path(), + 'GIT_TEST_CMP': diff.full_path() + ' -u', + 'GIT_TEST_GITPERLLIB': meson.project_build_root() / 'perl', + 'GIT_TEST_MERGE_TOOLS_DIR': meson.project_source_root() / 'mergetools', + 'GIT_TEST_POPATH': meson.project_source_root() / 'po', + 'GIT_TEST_TEMPLATE_DIR': meson.project_build_root() / 'templates', + 'GIT_TEST_TEXTDOMAINDIR': meson.project_build_root() / 'po', + 'PAGER_ENV': get_option('pager_environment'), + 'PERL_PATH': perl.found() ? perl.full_path() : '', + 'PYTHON_PATH': python.found () ? python.full_path() : '', + 'SHELL_PATH': shell.full_path(), + 'TAR': tar.full_path(), + 'TEST_OUTPUT_DIRECTORY': test_output_directory, + 'TEST_SHELL_PATH': shell.full_path(), +} + if value != '' and cygpath.found() + value = run_command(cygpath, value, check: true).stdout().strip() + endif + build_options_config.set_quoted(key, value) +endforeach + +configure_file( + input: 'GIT-BUILD-OPTIONS.in', + output: 'GIT-BUILD-OPTIONS', + configuration: build_options_config, +) + +# Build a separate library for "version.c" so that we do not have to rebuild +# everything when the current Git commit changes. TODO: this only gets set up +# at configuration time, so we do not notice version changes unless the build +# instructions get regenerated. We should refactor the source file such that we +# can substitute tags in the file via `vcs_tag()`. +libgit_version_library = static_library('git-version', + sources: ['version.c'], + c_args: libgit_c_args + [ + '-DGIT_VERSION="' + meson.project_version() + '"', + '-DGIT_USER_AGENT="' + 'git/' + meson.project_version() + '"', + '-DGIT_BUILT_FROM_COMMIT="' + run_command('git', 'rev-parse', '-q', '--verify', 'HEAD', check: false).stdout().strip() + '"', + ], + include_directories: libgit_include_directories, +) + +libgit_library = static_library('git', + sources: libgit_sources, + c_args: libgit_c_args, + link_with: libgit_version_library, + include_directories: libgit_include_directories, +) + +libgit = declare_dependency( + compile_args: libgit_c_args, + link_with: libgit_library, + dependencies: libgit_dependencies, + include_directories: libgit_include_directories, +) + +common_main_sources = ['common-main.c'] +common_main_link_args = [ ] +if host_machine.system() == 'windows' + # TODO: wire these up properly. + common_main_sources += import('windows').compile_resources('git.rc', args: [ + '-DMAJOR=1', + '-DMINOR=1', + '-DMICRO=1', + '-DPATCHLEVEL=0', + '-DGIT_VERSION=\\\"' + meson.project_version() + '.GIT\\\"', + ]) + if compiler.get_argument_syntax() == 'gcc' + common_main_link_args += [ + '-municode', + '-Wl,-nxcompat', + '-Wl,-dynamicbase', + '-Wl,-pic-executable,-e,mainCRTStartup', + '-Wl,-subsystem,console', + ] + elif compiler.get_argument_syntax() == 'msvc' + common_main_link_args += [ + '/NOLOGO', + '/ENTRY:wmainCRTStartup', + '/SUBSYSTEM:CONSOLE', + 'invalidcontinue.obj', + ] + else + error('Unsupported compiler ' + compiler.get_id()) + endif +endif +common_main_library = static_library('common-main', + sources: common_main_sources, + c_args: libgit_c_args, + include_directories: libgit_include_directories, +) +common_main = declare_dependency( + link_with: common_main_library, + link_args: common_main_link_args, +) + +bin_wrappers = [ ] +test_dependencies = [ ] + +git = executable('git', + sources: builtin_sources + 'git.c', + dependencies: [libgit, common_main], + install: true, + install_dir: get_option('libexecdir') / 'git-core', +) +bin_wrappers += git + +test_dependencies += executable('git-daemon', + sources: 'daemon.c', + dependencies: [libgit, common_main], + install: true, + install_dir: get_option('libexecdir') / 'git-core', +) + +test_dependencies += executable('git-sh-i18n--envsubst', + sources: 'sh-i18n--envsubst.c', + dependencies: [libgit, common_main], + install: true, + install_dir: get_option('libexecdir') / 'git-core', +) + +bin_wrappers += executable('git-shell', + sources: 'shell.c', + dependencies: [libgit, common_main], + install: true, + install_dir: get_option('libexecdir') / 'git-core', +) + +test_dependencies += executable('git-http-backend', + sources: 'http-backend.c', + dependencies: [libgit, common_main], + install: true, + install_dir: get_option('libexecdir') / 'git-core', +) + +bin_wrappers += executable('scalar', + sources: 'scalar.c', + dependencies: [libgit, common_main], + install: true, + install_dir: get_option('libexecdir') / 'git-core', +) + +if get_option('curl').enabled() + curl_sources = [ + 'http.c', + 'http-walker.c', + ] + + git_remote_http = executable('git-remote-http', + sources: curl_sources + 'remote-curl.c', + dependencies: [libgit, common_main], + install: true, + install_dir: get_option('libexecdir') / 'git-core', + ) + test_dependencies += git_remote_http + + test_dependencies += executable('git-http-fetch', + sources: curl_sources + 'http-fetch.c', + dependencies: [libgit, common_main], + install: true, + install_dir: get_option('libexecdir') / 'git-core', + ) + + if expat.found() + test_dependencies += executable('git-http-push', + sources: curl_sources + 'http-push.c', + dependencies: [libgit, common_main], + install: true, + install_dir: get_option('libexecdir') / 'git-core', + ) + endif + + foreach alias : [ 'git-remote-https', 'git-remote-ftp', 'git-remote-ftps' ] + test_dependencies += executable(alias, + objects: git.extract_all_objects(recursive: false), + dependencies: [libgit, common_main], + ) + + install_symlink(alias + executable_suffix, + install_dir: get_option('libexecdir') / 'git-core', + pointing_to: 'git-remote-http', + ) + endforeach +endif + +imap_send_sources = ['imap-send.c'] +if use_curl_for_imap_send + imap_send_sources += curl_sources +endif + +test_dependencies += executable('git-imap-send', + sources: imap_send_sources, + dependencies: [libgit, common_main], + install: true, + install_dir: get_option('libexecdir') / 'git-core', +) + +foreach alias : [ 'git-receive-pack', 'git-upload-archive', 'git-upload-pack' ] + bin_wrappers += executable(alias, + objects: git.extract_all_objects(recursive: false), + dependencies: [libgit, common_main], + ) + + install_symlink(alias + executable_suffix, + install_dir: get_option('libexecdir') / 'git-core', + pointing_to: 'git-remote-http', + ) +endforeach + +foreach symlink : [ + 'git', + 'git-http-backend', + 'git-receive-pack', + 'git-shell', + 'git-upload-archive', + 'git-upload-pack', + 'scalar', +] + install_symlink(symlink, + install_dir: get_option('bindir'), + pointing_to: fs.relative_to(get_option('libexecdir') / 'git-core' / symlink, get_option('bindir')), + ) +endforeach + +script_sh_config = configuration_data() +script_sh_config.set('BROKEN_PATH_FIX', '') +script_sh_config.set('DIFF', fs.as_posix(diff.full_path())) +script_sh_config.set('PAGER_ENV', get_option('pager_environment')) +script_sh_config.set('PERL_PATH', perl.found() ? fs.as_posix(perl.full_path()) : '') +script_sh_config.set('SHELL_PATH', fs.as_posix(shell.full_path())) +script_sh_config.set_quoted('LOCALEDIR', fs.as_posix(get_option('prefix') / get_option('localedir'))) +if intl.found() + script_sh_config.set('USE_GETTEXT_SCHEME', '') +else + script_sh_config.set('USE_GETTEXT_SCHEME', 'fallthrough') +endif +script_sh_config.set('GITWEBDIR', fs.as_posix(get_option('prefix') / get_option('datadir') / 'gitweb')) + +scripts_sh = [ + 'git-difftool--helper.sh', + 'git-filter-branch.sh', + 'git-merge-octopus.sh', + 'git-merge-one-file.sh', + 'git-merge-resolve.sh', + 'git-mergetool.sh', + 'git-quiltimport.sh', + 'git-request-pull.sh', + 'git-submodule.sh', + 'git-web--browse.sh', +] + +if perl_features_enabled + scripts_sh += 'git-instaweb.sh' +endif + +foreach script : scripts_sh + configure_file( + input: script, + output: fs.stem(script), + configuration: script_sh_config, + install: true, + install_dir: get_option('libexecdir') / 'git-core', + ) +endforeach + +scripts_lib = [ + 'git-mergetool--lib.sh', + 'git-sh-i18n.sh', + 'git-sh-setup.sh', +] + +foreach script : scripts_lib + configure_file( + input: script, + output: fs.stem(script), + configuration: script_sh_config, + install: true, + install_dir: get_option('libexecdir') / 'git-core', + ) +endforeach + +if perl_features_enabled + scripts_perl = [ + 'git-archimport.perl', + 'git-cvsexportcommit.perl', + 'git-cvsimport.perl', + 'git-cvsserver.perl', + 'git-send-email.perl', + 'git-svn.perl', + ] + + pathsep = ':' + if host_machine.system() == 'windows' + pathsep = ';' + endif + + perl_header_template = 'perl/header_templates/fixed_prefix.template.pl' + if get_option('runtime_prefix') + perl_header_template = 'perl/header_templates/runtime_prefix.template.pl' + endif + + perl_header = configure_file( + input: perl_header_template, + output: 'GIT-PERL-HEADER', + configuration: { + 'GITEXECDIR_REL': get_option('libexecdir') / 'git-core', + 'PERLLIBDIR_REL': get_option('datadir') / 'perl5', + 'LOCALEDIR_REL': get_option('datadir') / 'locale', + 'INSTLIBDIR': get_option('datadir') / 'perl5', + 'PATHSEP': pathsep, + }, + ) + + foreach script : scripts_perl + generated_script = custom_target(script, + input: script, + output: fs.stem(script), + command: [ + shell, + meson.project_source_root() / 'generate-perl.sh', + meson.project_version(), + perl_header, + perl.full_path(), + '@INPUT@', + '@OUTPUT@', + ], + install: true, + install_dir: get_option('datadir') / 'perl5', + ) + test_dependencies += generated_script + if script == 'git-cvsserver.perl' + bin_wrappers += generated_script + endif + endforeach + + subdir('perl') +endif + +if python.found() + scripts_python = [ + 'git-p4.py' + ] + + foreach script : scripts_python + fs.copyfile(script, fs.stem(script), + install: true, + install_dir: get_option('libexecdir') / 'git-core', + ) + endforeach +endif + +mergetools = [ + 'mergetools/araxis', + 'mergetools/bc', + 'mergetools/codecompare', + 'mergetools/deltawalker', + 'mergetools/diffmerge', + 'mergetools/diffuse', + 'mergetools/ecmerge', + 'mergetools/emerge', + 'mergetools/examdiff', + 'mergetools/guiffy', + 'mergetools/gvimdiff', + 'mergetools/kdiff3', + 'mergetools/kompare', + 'mergetools/meld', + 'mergetools/nvimdiff', + 'mergetools/opendiff', + 'mergetools/p4merge', + 'mergetools/smerge', + 'mergetools/tkdiff', + 'mergetools/tortoisemerge', + 'mergetools/vimdiff', + 'mergetools/vscode', + 'mergetools/winmerge', + 'mergetools/xxdiff', +] + +foreach mergetool : mergetools + install_data(mergetool, install_dir: get_option('libexecdir') / 'git-core' / 'mergetools') +endforeach + +if intl.found() + subdir('po') +endif +subdir('contrib') +subdir('gitweb') +subdir('templates') + +# Everything but the bin-wrappers need to come before this target such that we +# can properly set up test dependencies. The bin-wrappers themselves are set up +# at configuration time, so these are fine. +if get_option('tests') + subdir('t') +endif + +subdir('bin-wrappers') diff --git a/meson_options.txt b/meson_options.txt new file mode 100644 index 0000000000..113863947f --- /dev/null +++ b/meson_options.txt @@ -0,0 +1,67 @@ +option('default_help_format', type: 'combo', choices: ['man', 'html', 'info'], value: 'man', + description: 'Format of installed documentation.') +option('default_pager', type: 'string', value: 'less', + description: 'Fall-back pager.') +option('default_editor', type: 'string', value: 'vi', + description: 'Fall-back editor.') +option('gitconfig', type: 'string', value: '/etc/gitconfig', + description: 'Path to the global git configuration file.') +option('gitattributes', type: 'string', value: '/etc/gitattributes', + description: 'Path to the global git attributes file.') +option('pager_environment', type: 'string', value: 'LESS=FRX LV=-c', + description: 'Environment used when spawning the pager') +option('runtime_prefix', type: 'boolean', value: false, + description: 'Resolve ancillary tooling and support files relative to the location of the runtime binary instead of hard-coding them into the binary.') + +option('curl', type: 'feature', value: 'enabled', + description: 'Build helpers used to access remotes with the HTTP transport.') +option('expat', type: 'feature', value: 'enabled', + description: 'Build helpers used to push to remotes with the HTTP transport.') +option('gettext', type: 'feature', value: 'enabled', + description: 'Build translation files.') +option('iconv', type: 'feature', value: 'enabled', + description: 'Support reencoding strings with different encodings.') +option('pcre2', type: 'feature', value: 'enabled', + description: 'Support Perl-compatible regular expressions in e.g. git-grep(1).') +option('perl', type: 'feature', value: 'enabled', + description: 'Build tools written in Perl.') +option('perl_cpan_fallback', type: 'boolean', value: true, + description: 'Install bundled copies of CPAN modules that serve as a fallback in case the modules are not available on the system.') +option('python', type: 'feature', value: 'enabled', + description: 'Build tools written in Python.') + +option('openssl', type: 'feature', value: 'auto', + description: 'Support access to HTTPS remotes. OpenSSL may still be pulled in if configured as SHA1 or SHA256 backend.') +option('CommonCrypto', type: 'feature', value: 'auto', + description: 'Build tools written in Python.') + +option('sha1_backend', type: 'combo', choices: ['openssl', 'block', 'sha1dc', 'common-crypto'], value: 'sha1dc', + description: 'The backend used for hashing objects with the SHA1 object format') +option('sha256_backend', type: 'combo', choices: ['openssl', 'nettle', 'gcrypt', 'block'], value: 'block', + description: 'The backend used for hashing objects with the SHA256 object format') + +option('gitweb_config', type: 'string', value: 'gitweb_config.perl') +option('gitweb_config_system', type: 'string', value: '/etc/gitweb.conf') +option('gitweb_config_common', type: 'string', value: '/etc/gitweb-common.conf') +option('gitweb_home_link_str', type: 'string', value: 'projects') +option('gitweb_sitename', type: 'string', value: '') +option('gitweb_projectroot', type: 'string', value: '/pub/git') +option('gitweb_project_maxdepth', type: 'string', value: '2007') +option('gitweb_export_ok', type: 'string', value: '') +option('gitweb_strict_export', type: 'string', value: '') +option('gitweb_base_url', type: 'string', value: '') +option('gitweb_list', type: 'string', value: '') +option('gitweb_hometext', type: 'string', value: 'indextext.html') +option('gitweb_css', type: 'string', value: 'static/gitweb.css') +option('gitweb_logo', type: 'string', value: 'static/git-logo.png') +option('gitweb_favicon', type: 'string', value: 'static/git-favicon.png') +option('gitweb_js', type: 'string', value: 'static/gitweb.js') +option('gitweb_site_html_head_string', type: 'string', value: '') +option('gitweb_site_header', type: 'string', value: '') +option('gitweb_site_footer', type: 'string', value: '') +option('highlight_bin', type: 'string', value: 'highlight') + +option('tests', type: 'boolean', value: true, + description: 'Enable building tests. This requires Perl, but is separate from the "perl" option such that you can build tests without Perl features enabled.') +option('test_output_directory', type: 'string', + description: 'Path to the directory used to store test outputs') diff --git a/perl/FromCPAN/Mail/meson.build b/perl/FromCPAN/Mail/meson.build new file mode 100644 index 0000000000..8cbd90ce18 --- /dev/null +++ b/perl/FromCPAN/Mail/meson.build @@ -0,0 +1,7 @@ +configure_file( + input: 'Address.pm', + output: 'Address.pm', + configuration: perl_config, + install: true, + install_dir: get_option('datadir') / 'perl5/FromCPAN/Mail', +) diff --git a/perl/FromCPAN/meson.build b/perl/FromCPAN/meson.build new file mode 100644 index 0000000000..ff88b35c2c --- /dev/null +++ b/perl/FromCPAN/meson.build @@ -0,0 +1,9 @@ +configure_file( + input: 'Error.pm', + output: 'Error.pm', + configuration: perl_config, + install: true, + install_dir: get_option('datadir') / 'perl5/FromCPAN', +) + +subdir('Mail') diff --git a/perl/Git/LoadCPAN/Mail/meson.build b/perl/Git/LoadCPAN/Mail/meson.build new file mode 100644 index 0000000000..fbf324307b --- /dev/null +++ b/perl/Git/LoadCPAN/Mail/meson.build @@ -0,0 +1,7 @@ +configure_file( + input: 'Address.pm', + output: 'Address.pm', + configuration: perl_config, + install: true, + install_dir: get_option('datadir') / 'perl5/Git/LoadCPAN/Mail', +) diff --git a/perl/Git/LoadCPAN/meson.build b/perl/Git/LoadCPAN/meson.build new file mode 100644 index 0000000000..542e108225 --- /dev/null +++ b/perl/Git/LoadCPAN/meson.build @@ -0,0 +1,9 @@ +configure_file( + input: 'Error.pm', + output: 'Error.pm', + configuration: perl_config, + install: true, + install_dir: get_option('datadir') / 'perl5/Git/LoadCPAN', +) + +subdir('Mail') diff --git a/perl/Git/SVN/Memoize/meson.build b/perl/Git/SVN/Memoize/meson.build new file mode 100644 index 0000000000..727375c833 --- /dev/null +++ b/perl/Git/SVN/Memoize/meson.build @@ -0,0 +1,7 @@ +configure_file( + input: 'YAML.pm', + output: 'YAML.pm', + configuration: perl_config, + install: true, + install_dir: get_option('datadir') / 'perl5/Git/SVN', +) diff --git a/perl/Git/SVN/meson.build b/perl/Git/SVN/meson.build new file mode 100644 index 0000000000..eccc3f2263 --- /dev/null +++ b/perl/Git/SVN/meson.build @@ -0,0 +1,20 @@ +foreach source : [ + 'Editor.pm', + 'Fetcher.pm', + 'GlobSpec.pm', + 'Log.pm', + 'Migration.pm', + 'Prompt.pm', + 'Ra.pm', + 'Utils.pm', +] + configure_file( + input: source, + output: source, + configuration: perl_config, + install: true, + install_dir: get_option('datadir') / 'perl5/Git/SVN', + ) +endforeach + +subdir('Memoize') diff --git a/perl/Git/meson.build b/perl/Git/meson.build new file mode 100644 index 0000000000..97bd62290d --- /dev/null +++ b/perl/Git/meson.build @@ -0,0 +1,18 @@ +foreach source : [ + 'I18N.pm', + 'IndexInfo.pm', + 'LoadCPAN.pm', + 'Packet.pm', + 'SVN.pm', +] + configure_file( + input: source, + output: source, + configuration: perl_config, + install: true, + install_dir: get_option('datadir') / 'perl5/Git', + ) +endforeach + +subdir('LoadCPAN') +subdir('SVN') diff --git a/perl/meson.build b/perl/meson.build new file mode 100644 index 0000000000..0a7bf41d5b --- /dev/null +++ b/perl/meson.build @@ -0,0 +1,18 @@ +perl_config = { + 'LOCALEDIR': get_option('prefix') / get_option('datadir') / 'locale', + 'NO_GETTEXT': iconv.found() ? '' : '1', + 'NO_PERL_CPAN_FALLBACKS': get_option('perl_cpan_fallback') ? '' : '1', +} + +configure_file( + input: 'Git.pm', + output: 'Git.pm', + configuration: perl_config, + install: true, + install_dir: get_option('datadir') / 'perl5', +) + +subdir('Git') +if get_option('perl_cpan_fallback') + subdir('FromCPAN') +endif diff --git a/po/meson.build b/po/meson.build new file mode 100644 index 0000000000..fb1b92eb0a --- /dev/null +++ b/po/meson.build @@ -0,0 +1,28 @@ +i18n = import('i18n') + +translations = i18n.gettext('git', + languages: [ + 'bg', + 'ca', + 'de', + 'el', + 'es', + 'fr', + 'id', + 'is', + 'it', + 'ko', + 'pl', + 'pt_PT', + 'ru', + 'sv', + 'tr', + 'uk', + 'vi', + 'zh_CN', + 'zh_TW', + ], + install: true, + install_dir: get_option('datadir'), +) +test_dependencies += translations[0] diff --git a/t/helper/meson.build b/t/helper/meson.build new file mode 100644 index 0000000000..5e83884246 --- /dev/null +++ b/t/helper/meson.build @@ -0,0 +1,91 @@ +test_tool_sources = [ + '../unit-tests/test-lib.c', + 'test-advise.c', + 'test-bitmap.c', + 'test-bloom.c', + 'test-bundle-uri.c', + 'test-cache-tree.c', + 'test-chmtime.c', + 'test-config.c', + 'test-crontab.c', + 'test-csprng.c', + 'test-date.c', + 'test-delete-gpgsig.c', + 'test-delta.c', + 'test-dir-iterator.c', + 'test-drop-caches.c', + 'test-dump-cache-tree.c', + 'test-dump-fsmonitor.c', + 'test-dump-split-index.c', + 'test-dump-untracked-cache.c', + 'test-env-helper.c', + 'test-example-tap.c', + 'test-find-pack.c', + 'test-fsmonitor-client.c', + 'test-genrandom.c', + 'test-genzeros.c', + 'test-getcwd.c', + 'test-hash-speed.c', + 'test-hash.c', + 'test-hashmap.c', + 'test-hexdump.c', + 'test-json-writer.c', + 'test-lazy-init-name-hash.c', + 'test-match-trees.c', + 'test-mergesort.c', + 'test-mktemp.c', + 'test-online-cpus.c', + 'test-pack-mtimes.c', + 'test-parse-options.c', + 'test-parse-pathspec-file.c', + 'test-partial-clone.c', + 'test-path-utils.c', + 'test-pcre2-config.c', + 'test-pkt-line.c', + 'test-proc-receive.c', + 'test-progress.c', + 'test-reach.c', + 'test-read-cache.c', + 'test-read-graph.c', + 'test-read-midx.c', + 'test-ref-store.c', + 'test-reftable.c', + 'test-regex.c', + 'test-repository.c', + 'test-revision-walking.c', + 'test-rot13-filter.c', + 'test-run-command.c', + 'test-scrap-cache-tree.c', + 'test-serve-v2.c', + 'test-sha1.c', + 'test-sha256.c', + 'test-sigchain.c', + 'test-simple-ipc.c', + 'test-string-list.c', + 'test-submodule-config.c', + 'test-submodule-nested-repo-config.c', + 'test-submodule.c', + 'test-subprocess.c', + 'test-tool.c', + 'test-trace2.c', + 'test-truncate.c', + 'test-userdiff.c', + 'test-wildmatch.c', + 'test-windows-named-pipe.c', + 'test-write-cache.c', + 'test-xml-encode.c', +] + +test_tool = executable('test-tool', + sources: test_tool_sources, + dependencies: [libgit, common_main], +) +bin_wrappers += test_tool +test_dependencies += test_tool + +test_fake_ssh = executable('test-fake-ssh', + sources: 'test-fake-ssh.c', + dependencies: [libgit, common_main], +) +bin_wrappers += test_fake_ssh +test_dependencies += test_fake_ssh diff --git a/t/meson.build b/t/meson.build new file mode 100644 index 0000000000..c6eb1129f8 --- /dev/null +++ b/t/meson.build @@ -0,0 +1,1107 @@ +awk = find_program('awk') + +clar_test_suites = [ + 'unit-tests/ctype.c', + 'unit-tests/strvec.c', +] + +clar_sources = [ + 'unit-tests/clar/clar.c', + 'unit-tests/unit-test.c', +] + +clar_decls_h = custom_target('clar_decls_h', + input: clar_test_suites, + output: 'clar-decls.h', + command : [shell, meson.current_source_dir() + '/unit-tests/generate-clar-decls.sh', '@OUTPUT@', '@INPUT@'], +) + +clar_suite = custom_target('clar_suite', + input: clar_decls_h, + output: 'clar.suite', + feed: true, + capture: true, + command : [awk, '-f', meson.current_source_dir() + '/unit-tests/clar-generate.awk'], +) + +clar_generated_sources = [ + clar_decls_h, + clar_suite, +] + +clar_unit_tests = executable('unit-tests', + sources: clar_sources + clar_generated_sources + clar_test_suites, + dependencies: [libgit, common_main], +) +test('unit-tests', clar_unit_tests) + +unit_test_programs = [ + 'unit-tests/t-example-decorate.c', + 'unit-tests/t-hash.c', + 'unit-tests/t-hashmap.c', + 'unit-tests/t-mem-pool.c', + 'unit-tests/t-oid-array.c', + 'unit-tests/t-oidmap.c', + 'unit-tests/t-oidtree.c', + 'unit-tests/t-prio-queue.c', + 'unit-tests/t-reftable-basics.c', + 'unit-tests/t-reftable-block.c', + 'unit-tests/t-reftable-merged.c', + 'unit-tests/t-reftable-pq.c', + 'unit-tests/t-reftable-readwrite.c', + 'unit-tests/t-reftable-record.c', + 'unit-tests/t-reftable-stack.c', + 'unit-tests/t-reftable-tree.c', + 'unit-tests/t-strbuf.c', + 'unit-tests/t-strcmp-offset.c', + 'unit-tests/t-trailer.c', + 'unit-tests/t-urlmatch-normalization.c', +] + +foreach unit_test_program : unit_test_programs + unit_test_name = fs.stem(unit_test_program) + unit_test = executable(unit_test_name, + sources: [ + 'unit-tests/test-lib.c', + 'unit-tests/lib-oid.c', + 'unit-tests/lib-reftable.c', + unit_test_program, + ], + dependencies: [libgit, common_main], + ) + test(unit_test_name, unit_test, + workdir: meson.current_source_dir(), + ) +endforeach + +subdir('helper') + +integration_tests = [ + 't0000-basic.sh', + 't0001-init.sh', + 't0002-gitfile.sh', + 't0003-attributes.sh', + 't0004-unwritable.sh', + 't0005-signals.sh', + 't0006-date.sh', + 't0007-git-var.sh', + 't0008-ignores.sh', + 't0010-racy-git.sh', + 't0012-help.sh', + 't0013-sha1dc.sh', + 't0014-alias.sh', + 't0017-env-helper.sh', + 't0018-advice.sh', + 't0019-json-writer.sh', + 't0020-crlf.sh', + 't0021-conversion.sh', + 't0022-crlf-rename.sh', + 't0023-crlf-am.sh', + 't0024-crlf-archive.sh', + 't0025-crlf-renormalize.sh', + 't0026-eol-config.sh', + 't0027-auto-crlf.sh', + 't0028-working-tree-encoding.sh', + 't0029-core-unsetenvvars.sh', + 't0030-stripspace.sh', + 't0033-safe-directory.sh', + 't0034-root-safe-directory.sh', + 't0035-safe-bare-repository.sh', + 't0040-parse-options.sh', + 't0041-usage.sh', + 't0050-filesystem.sh', + 't0051-windows-named-pipe.sh', + 't0052-simple-ipc.sh', + 't0055-beyond-symlinks.sh', + 't0056-git-C.sh', + 't0060-path-utils.sh', + 't0061-run-command.sh', + 't0062-revision-walking.sh', + 't0063-string-list.sh', + 't0066-dir-iterator.sh', + 't0067-parse_pathspec_file.sh', + 't0068-for-each-repo.sh', + 't0070-fundamental.sh', + 't0071-sort.sh', + 't0080-unit-test-output.sh', + 't0081-find-pack.sh', + 't0090-cache-tree.sh', + 't0091-bugreport.sh', + 't0092-diagnose.sh', + 't0095-bloom.sh', + 't0100-previous.sh', + 't0101-at-syntax.sh', + 't0200-gettext-basic.sh', + 't0201-gettext-fallbacks.sh', + 't0202-gettext-perl.sh', + 't0203-gettext-setlocale-sanity.sh', + 't0204-gettext-reencode-sanity.sh', + 't0210-trace2-normal.sh', + 't0211-trace2-perf.sh', + 't0212-trace2-event.sh', + 't0300-credentials.sh', + 't0301-credential-cache.sh', + 't0302-credential-store.sh', + 't0303-credential-external.sh', + 't0410-partial-clone.sh', + 't0411-clone-from-partial.sh', + 't0450-txt-doc-vs-help.sh', + 't0500-progress-display.sh', + 't0600-reffiles-backend.sh', + 't0601-reffiles-pack-refs.sh', + 't0602-reffiles-fsck.sh', + 't0610-reftable-basics.sh', + 't0611-reftable-httpd.sh', + 't0612-reftable-jgit-compatibility.sh', + 't0613-reftable-write-options.sh', + 't1000-read-tree-m-3way.sh', + 't1001-read-tree-m-2way.sh', + 't1002-read-tree-m-u-2way.sh', + 't1003-read-tree-prefix.sh', + 't1004-read-tree-m-u-wf.sh', + 't1005-read-tree-reset.sh', + 't1006-cat-file.sh', + 't1007-hash-object.sh', + 't1008-read-tree-overlay.sh', + 't1009-read-tree-new-index.sh', + 't1010-mktree.sh', + 't1011-read-tree-sparse-checkout.sh', + 't1012-read-tree-df.sh', + 't1013-read-tree-submodule.sh', + 't1014-read-tree-confusing.sh', + 't1015-read-index-unmerged.sh', + 't1016-compatObjectFormat.sh', + 't1020-subdirectory.sh', + 't1021-rerere-in-workdir.sh', + 't1022-read-tree-partial-clone.sh', + 't1050-large.sh', + 't1051-large-conversion.sh', + 't1060-object-corruption.sh', + 't1090-sparse-checkout-scope.sh', + 't1091-sparse-checkout-builtin.sh', + 't1092-sparse-checkout-compatibility.sh', + 't1100-commit-tree-options.sh', + 't1300-config.sh', + 't1301-shared-repo.sh', + 't1302-repo-version.sh', + 't1303-wacky-config.sh', + 't1304-default-acl.sh', + 't1305-config-include.sh', + 't1306-xdg-files.sh', + 't1307-config-blob.sh', + 't1308-config-set.sh', + 't1309-early-config.sh', + 't1310-config-default.sh', + 't1350-config-hooks-path.sh', + 't1400-update-ref.sh', + 't1401-symbolic-ref.sh', + 't1402-check-ref-format.sh', + 't1403-show-ref.sh', + 't1404-update-ref-errors.sh', + 't1405-main-ref-store.sh', + 't1406-submodule-ref-store.sh', + 't1407-worktree-ref-store.sh', + 't1408-packed-refs.sh', + 't1409-avoid-packing-refs.sh', + 't1410-reflog.sh', + 't1411-reflog-show.sh', + 't1412-reflog-loop.sh', + 't1413-reflog-detach.sh', + 't1414-reflog-walk.sh', + 't1415-worktree-refs.sh', + 't1416-ref-transaction-hooks.sh', + 't1417-reflog-updateref.sh', + 't1418-reflog-exists.sh', + 't1419-exclude-refs.sh', + 't1420-lost-found.sh', + 't1430-bad-ref-name.sh', + 't1450-fsck.sh', + 't1451-fsck-buffer.sh', + 't1460-refs-migrate.sh', + 't1500-rev-parse.sh', + 't1501-work-tree.sh', + 't1502-rev-parse-parseopt.sh', + 't1503-rev-parse-verify.sh', + 't1504-ceiling-dirs.sh', + 't1505-rev-parse-last.sh', + 't1506-rev-parse-diagnosis.sh', + 't1507-rev-parse-upstream.sh', + 't1508-at-combinations.sh', + 't1509-root-work-tree.sh', + 't1510-repo-setup.sh', + 't1511-rev-parse-caret.sh', + 't1512-rev-parse-disambiguation.sh', + 't1513-rev-parse-prefix.sh', + 't1514-rev-parse-push.sh', + 't1515-rev-parse-outside-repo.sh', + 't1517-outside-repo.sh', + 't1600-index.sh', + 't1601-index-bogus.sh', + 't1700-split-index.sh', + 't1701-racy-split-index.sh', + 't1800-hook.sh', + 't2000-conflict-when-checking-files-out.sh', + 't2002-checkout-cache-u.sh', + 't2003-checkout-cache-mkdir.sh', + 't2004-checkout-cache-temp.sh', + 't2005-checkout-index-symlinks.sh', + 't2006-checkout-index-basic.sh', + 't2007-checkout-symlink.sh', + 't2008-checkout-subdir.sh', + 't2009-checkout-statinfo.sh', + 't2010-checkout-ambiguous.sh', + 't2011-checkout-invalid-head.sh', + 't2012-checkout-last.sh', + 't2013-checkout-submodule.sh', + 't2014-checkout-switch.sh', + 't2015-checkout-unborn.sh', + 't2016-checkout-patch.sh', + 't2017-checkout-orphan.sh', + 't2018-checkout-branch.sh', + 't2019-checkout-ambiguous-ref.sh', + 't2020-checkout-detach.sh', + 't2021-checkout-overwrite.sh', + 't2022-checkout-paths.sh', + 't2023-checkout-m.sh', + 't2024-checkout-dwim.sh', + 't2025-checkout-no-overlay.sh', + 't2026-checkout-pathspec-file.sh', + 't2027-checkout-track.sh', + 't2030-unresolve-info.sh', + 't2050-git-dir-relative.sh', + 't2060-switch.sh', + 't2070-restore.sh', + 't2071-restore-patch.sh', + 't2072-restore-pathspec-file.sh', + 't2080-parallel-checkout-basics.sh', + 't2081-parallel-checkout-collisions.sh', + 't2082-parallel-checkout-attributes.sh', + 't2100-update-cache-badpath.sh', + 't2101-update-index-reupdate.sh', + 't2102-update-index-symlinks.sh', + 't2103-update-index-ignore-missing.sh', + 't2104-update-index-skip-worktree.sh', + 't2105-update-index-gitfile.sh', + 't2106-update-index-assume-unchanged.sh', + 't2107-update-index-basic.sh', + 't2108-update-index-refresh-racy.sh', + 't2200-add-update.sh', + 't2201-add-update-typechange.sh', + 't2202-add-addremove.sh', + 't2203-add-intent.sh', + 't2204-add-ignored.sh', + 't2205-add-worktree-config.sh', + 't2300-cd-to-toplevel.sh', + 't2400-worktree-add.sh', + 't2401-worktree-prune.sh', + 't2402-worktree-list.sh', + 't2403-worktree-move.sh', + 't2404-worktree-config.sh', + 't2405-worktree-submodule.sh', + 't2406-worktree-repair.sh', + 't2407-worktree-heads.sh', + 't2500-untracked-overwriting.sh', + 't2501-cwd-empty.sh', + 't3000-ls-files-others.sh', + 't3001-ls-files-others-exclude.sh', + 't3002-ls-files-dashpath.sh', + 't3003-ls-files-exclude.sh', + 't3004-ls-files-basic.sh', + 't3005-ls-files-relative.sh', + 't3006-ls-files-long.sh', + 't3007-ls-files-recurse-submodules.sh', + 't3008-ls-files-lazy-init-name-hash.sh', + 't3009-ls-files-others-nonsubmodule.sh', + 't3010-ls-files-killed-modified.sh', + 't3011-common-prefixes-and-directory-traversal.sh', + 't3012-ls-files-dedup.sh', + 't3013-ls-files-format.sh', + 't3020-ls-files-error-unmatch.sh', + 't3040-subprojects-basic.sh', + 't3050-subprojects-fetch.sh', + 't3060-ls-files-with-tree.sh', + 't3070-wildmatch.sh', + 't3100-ls-tree-restrict.sh', + 't3101-ls-tree-dirname.sh', + 't3102-ls-tree-wildcards.sh', + 't3103-ls-tree-misc.sh', + 't3104-ls-tree-format.sh', + 't3105-ls-tree-output.sh', + 't3200-branch.sh', + 't3201-branch-contains.sh', + 't3202-show-branch.sh', + 't3203-branch-output.sh', + 't3204-branch-name-interpretation.sh', + 't3205-branch-color.sh', + 't3206-range-diff.sh', + 't3207-branch-submodule.sh', + 't3211-peel-ref.sh', + 't3300-funny-names.sh', + 't3301-notes.sh', + 't3302-notes-index-expensive.sh', + 't3303-notes-subtrees.sh', + 't3304-notes-mixed.sh', + 't3305-notes-fanout.sh', + 't3306-notes-prune.sh', + 't3307-notes-man.sh', + 't3308-notes-merge.sh', + 't3309-notes-merge-auto-resolve.sh', + 't3310-notes-merge-manual-resolve.sh', + 't3311-notes-merge-fanout.sh', + 't3320-notes-merge-worktrees.sh', + 't3321-notes-stripspace.sh', + 't3400-rebase.sh', + 't3401-rebase-and-am-rename.sh', + 't3402-rebase-merge.sh', + 't3403-rebase-skip.sh', + 't3404-rebase-interactive.sh', + 't3405-rebase-malformed.sh', + 't3406-rebase-message.sh', + 't3407-rebase-abort.sh', + 't3408-rebase-multi-line.sh', + 't3409-rebase-environ.sh', + 't3412-rebase-root.sh', + 't3413-rebase-hook.sh', + 't3415-rebase-autosquash.sh', + 't3416-rebase-onto-threedots.sh', + 't3417-rebase-whitespace-fix.sh', + 't3418-rebase-continue.sh', + 't3419-rebase-patch-id.sh', + 't3420-rebase-autostash.sh', + 't3421-rebase-topology-linear.sh', + 't3422-rebase-incompatible-options.sh', + 't3423-rebase-reword.sh', + 't3424-rebase-empty.sh', + 't3425-rebase-topology-merges.sh', + 't3426-rebase-submodule.sh', + 't3427-rebase-subtree.sh', + 't3428-rebase-signoff.sh', + 't3429-rebase-edit-todo.sh', + 't3430-rebase-merges.sh', + 't3431-rebase-fork-point.sh', + 't3432-rebase-fast-forward.sh', + 't3433-rebase-across-mode-change.sh', + 't3434-rebase-i18n.sh', + 't3435-rebase-gpg-sign.sh', + 't3436-rebase-more-options.sh', + 't3437-rebase-fixup-options.sh', + 't3438-rebase-broken-files.sh', + 't3500-cherry.sh', + 't3501-revert-cherry-pick.sh', + 't3502-cherry-pick-merge.sh', + 't3503-cherry-pick-root.sh', + 't3504-cherry-pick-rerere.sh', + 't3505-cherry-pick-empty.sh', + 't3506-cherry-pick-ff.sh', + 't3507-cherry-pick-conflict.sh', + 't3508-cherry-pick-many-commits.sh', + 't3509-cherry-pick-merge-df.sh', + 't3510-cherry-pick-sequence.sh', + 't3511-cherry-pick-x.sh', + 't3512-cherry-pick-submodule.sh', + 't3513-revert-submodule.sh', + 't3514-cherry-pick-revert-gpg.sh', + 't3600-rm.sh', + 't3601-rm-pathspec-file.sh', + 't3602-rm-sparse-checkout.sh', + 't3650-replay-basics.sh', + 't3700-add.sh', + 't3701-add-interactive.sh', + 't3702-add-edit.sh', + 't3703-add-magic-pathspec.sh', + 't3704-add-pathspec-file.sh', + 't3705-add-sparse-checkout.sh', + 't3800-mktag.sh', + 't3900-i18n-commit.sh', + 't3901-i18n-patch.sh', + 't3902-quoted.sh', + 't3903-stash.sh', + 't3904-stash-patch.sh', + 't3905-stash-include-untracked.sh', + 't3906-stash-submodule.sh', + 't3907-stash-show-config.sh', + 't3908-stash-in-worktree.sh', + 't3909-stash-pathspec-file.sh', + 't3910-mac-os-precompose.sh', + 't3920-crlf-messages.sh', + 't4000-diff-format.sh', + 't4001-diff-rename.sh', + 't4002-diff-basic.sh', + 't4003-diff-rename-1.sh', + 't4004-diff-rename-symlink.sh', + 't4005-diff-rename-2.sh', + 't4006-diff-mode.sh', + 't4007-rename-3.sh', + 't4008-diff-break-rewrite.sh', + 't4009-diff-rename-4.sh', + 't4010-diff-pathspec.sh', + 't4011-diff-symlink.sh', + 't4012-diff-binary.sh', + 't4013-diff-various.sh', + 't4014-format-patch.sh', + 't4015-diff-whitespace.sh', + 't4016-diff-quote.sh', + 't4017-diff-retval.sh', + 't4018-diff-funcname.sh', + 't4019-diff-wserror.sh', + 't4020-diff-external.sh', + 't4021-format-patch-numbered.sh', + 't4022-diff-rewrite.sh', + 't4023-diff-rename-typechange.sh', + 't4024-diff-optimize-common.sh', + 't4025-hunk-header.sh', + 't4026-color.sh', + 't4027-diff-submodule.sh', + 't4028-format-patch-mime-headers.sh', + 't4029-diff-trailing-space.sh', + 't4030-diff-textconv.sh', + 't4031-diff-rewrite-binary.sh', + 't4032-diff-inter-hunk-context.sh', + 't4033-diff-patience.sh', + 't4034-diff-words.sh', + 't4035-diff-quiet.sh', + 't4036-format-patch-signer-mime.sh', + 't4037-diff-r-t-dirs.sh', + 't4038-diff-combined.sh', + 't4039-diff-assume-unchanged.sh', + 't4040-whitespace-status.sh', + 't4041-diff-submodule-option.sh', + 't4042-diff-textconv-caching.sh', + 't4043-diff-rename-binary.sh', + 't4044-diff-index-unique-abbrev.sh', + 't4045-diff-relative.sh', + 't4046-diff-unmerged.sh', + 't4047-diff-dirstat.sh', + 't4048-diff-combined-binary.sh', + 't4049-diff-stat-count.sh', + 't4050-diff-histogram.sh', + 't4051-diff-function-context.sh', + 't4052-stat-output.sh', + 't4053-diff-no-index.sh', + 't4054-diff-bogus-tree.sh', + 't4055-diff-context.sh', + 't4056-diff-order.sh', + 't4057-diff-combined-paths.sh', + 't4058-diff-duplicates.sh', + 't4059-diff-submodule-not-initialized.sh', + 't4060-diff-submodule-option-diff-format.sh', + 't4061-diff-indent.sh', + 't4062-diff-pickaxe.sh', + 't4063-diff-blobs.sh', + 't4064-diff-oidfind.sh', + 't4065-diff-anchored.sh', + 't4066-diff-emit-delay.sh', + 't4067-diff-partial-clone.sh', + 't4068-diff-symmetric-merge-base.sh', + 't4069-remerge-diff.sh', + 't4100-apply-stat.sh', + 't4101-apply-nonl.sh', + 't4102-apply-rename.sh', + 't4103-apply-binary.sh', + 't4104-apply-boundary.sh', + 't4105-apply-fuzz.sh', + 't4106-apply-stdin.sh', + 't4107-apply-ignore-whitespace.sh', + 't4108-apply-threeway.sh', + 't4109-apply-multifrag.sh', + 't4110-apply-scan.sh', + 't4111-apply-subdir.sh', + 't4112-apply-renames.sh', + 't4113-apply-ending.sh', + 't4114-apply-typechange.sh', + 't4115-apply-symlink.sh', + 't4116-apply-reverse.sh', + 't4117-apply-reject.sh', + 't4118-apply-empty-context.sh', + 't4119-apply-config.sh', + 't4120-apply-popt.sh', + 't4121-apply-diffs.sh', + 't4122-apply-symlink-inside.sh', + 't4123-apply-shrink.sh', + 't4124-apply-ws-rule.sh', + 't4125-apply-ws-fuzz.sh', + 't4126-apply-empty.sh', + 't4127-apply-same-fn.sh', + 't4128-apply-root.sh', + 't4129-apply-samemode.sh', + 't4130-apply-criss-cross-rename.sh', + 't4131-apply-fake-ancestor.sh', + 't4132-apply-removal.sh', + 't4133-apply-filenames.sh', + 't4134-apply-submodule.sh', + 't4135-apply-weird-filenames.sh', + 't4136-apply-check.sh', + 't4137-apply-submodule.sh', + 't4138-apply-ws-expansion.sh', + 't4139-apply-escape.sh', + 't4140-apply-ita.sh', + 't4141-apply-too-large.sh', + 't4150-am.sh', + 't4151-am-abort.sh', + 't4152-am-subjects.sh', + 't4153-am-resume-override-opts.sh', + 't4200-rerere.sh', + 't4201-shortlog.sh', + 't4202-log.sh', + 't4203-mailmap.sh', + 't4204-patch-id.sh', + 't4205-log-pretty-formats.sh', + 't4206-log-follow-harder-copies.sh', + 't4207-log-decoration-colors.sh', + 't4208-log-magic-pathspec.sh', + 't4209-log-pickaxe.sh', + 't4210-log-i18n.sh', + 't4211-line-log.sh', + 't4212-log-corrupt.sh', + 't4213-log-tabexpand.sh', + 't4214-log-graph-octopus.sh', + 't4215-log-skewed-merges.sh', + 't4216-log-bloom.sh', + 't4217-log-limit.sh', + 't4252-am-options.sh', + 't4253-am-keep-cr-dos.sh', + 't4254-am-corrupt.sh', + 't4255-am-submodule.sh', + 't4256-am-format-flowed.sh', + 't4257-am-interactive.sh', + 't4258-am-quoted-cr.sh', + 't4300-merge-tree.sh', + 't4301-merge-tree-write-tree.sh', + 't5000-tar-tree.sh', + 't5001-archive-attr.sh', + 't5002-archive-attr-pattern.sh', + 't5003-archive-zip.sh', + 't5004-archive-corner-cases.sh', + 't5100-mailinfo.sh', + 't5150-request-pull.sh', + 't5200-update-server-info.sh', + 't5300-pack-object.sh', + 't5301-sliding-window.sh', + 't5302-pack-index.sh', + 't5303-pack-corruption-resilience.sh', + 't5304-prune.sh', + 't5305-include-tag.sh', + 't5306-pack-nobase.sh', + 't5307-pack-missing-commit.sh', + 't5308-pack-detect-duplicates.sh', + 't5309-pack-delta-cycles.sh', + 't5310-pack-bitmaps.sh', + 't5311-pack-bitmaps-shallow.sh', + 't5312-prune-corruption.sh', + 't5313-pack-bounds-checks.sh', + 't5314-pack-cycle-detection.sh', + 't5315-pack-objects-compression.sh', + 't5316-pack-delta-depth.sh', + 't5317-pack-objects-filter-objects.sh', + 't5318-commit-graph.sh', + 't5319-multi-pack-index.sh', + 't5320-delta-islands.sh', + 't5321-pack-large-objects.sh', + 't5322-pack-objects-sparse.sh', + 't5323-pack-redundant.sh', + 't5324-split-commit-graph.sh', + 't5325-reverse-index.sh', + 't5326-multi-pack-bitmaps.sh', + 't5327-multi-pack-bitmaps-rev.sh', + 't5328-commit-graph-64bit-time.sh', + 't5329-pack-objects-cruft.sh', + 't5330-no-lazy-fetch-with-commit-graph.sh', + 't5331-pack-objects-stdin.sh', + 't5332-multi-pack-reuse.sh', + 't5333-pseudo-merge-bitmaps.sh', + 't5334-incremental-multi-pack-index.sh', + 't5351-unpack-large-objects.sh', + 't5400-send-pack.sh', + 't5401-update-hooks.sh', + 't5402-post-merge-hook.sh', + 't5403-post-checkout-hook.sh', + 't5404-tracking-branches.sh', + 't5405-send-pack-rewind.sh', + 't5406-remote-rejects.sh', + 't5407-post-rewrite-hook.sh', + 't5408-send-pack-stdin.sh', + 't5409-colorize-remote-messages.sh', + 't5410-receive-pack-alternates.sh', + 't5411-proc-receive-hook.sh', + 't5500-fetch-pack.sh', + 't5501-fetch-push-alternates.sh', + 't5502-quickfetch.sh', + 't5503-tagfollow.sh', + 't5504-fetch-receive-strict.sh', + 't5505-remote.sh', + 't5506-remote-groups.sh', + 't5507-remote-environment.sh', + 't5509-fetch-push-namespaces.sh', + 't5510-fetch.sh', + 't5511-refspec.sh', + 't5512-ls-remote.sh', + 't5513-fetch-track.sh', + 't5514-fetch-multiple.sh', + 't5515-fetch-merge-logic.sh', + 't5516-fetch-push.sh', + 't5517-push-mirror.sh', + 't5518-fetch-exit-status.sh', + 't5519-push-alternates.sh', + 't5520-pull.sh', + 't5521-pull-options.sh', + 't5522-pull-symlink.sh', + 't5523-push-upstream.sh', + 't5524-pull-msg.sh', + 't5525-fetch-tagopt.sh', + 't5526-fetch-submodules.sh', + 't5527-fetch-odd-refs.sh', + 't5528-push-default.sh', + 't5529-push-errors.sh', + 't5530-upload-pack-error.sh', + 't5531-deep-submodule-push.sh', + 't5532-fetch-proxy.sh', + 't5533-push-cas.sh', + 't5534-push-signed.sh', + 't5535-fetch-push-symref.sh', + 't5536-fetch-conflicts.sh', + 't5537-fetch-shallow.sh', + 't5538-push-shallow.sh', + 't5539-fetch-http-shallow.sh', + 't5540-http-push-webdav.sh', + 't5541-http-push-smart.sh', + 't5542-push-http-shallow.sh', + 't5543-atomic-push.sh', + 't5544-pack-objects-hook.sh', + 't5545-push-options.sh', + 't5546-receive-limits.sh', + 't5547-push-quarantine.sh', + 't5548-push-porcelain.sh', + 't5549-fetch-push-http.sh', + 't5550-http-fetch-dumb.sh', + 't5551-http-fetch-smart.sh', + 't5552-skipping-fetch-negotiator.sh', + 't5553-set-upstream.sh', + 't5554-noop-fetch-negotiator.sh', + 't5555-http-smart-common.sh', + 't5557-http-get.sh', + 't5558-clone-bundle-uri.sh', + 't5559-http-fetch-smart-http2.sh', + 't5560-http-backend-noserver.sh', + 't5561-http-backend.sh', + 't5562-http-backend-content-length.sh', + 't5563-simple-http-auth.sh', + 't5564-http-proxy.sh', + 't5570-git-daemon.sh', + 't5571-pre-push-hook.sh', + 't5572-pull-submodule.sh', + 't5573-pull-verify-signatures.sh', + 't5574-fetch-output.sh', + 't5580-unc-paths.sh', + 't5581-http-curl-verbose.sh', + 't5582-fetch-negative-refspec.sh', + 't5583-push-branches.sh', + 't5600-clone-fail-cleanup.sh', + 't5601-clone.sh', + 't5602-clone-remote-exec.sh', + 't5603-clone-dirname.sh', + 't5604-clone-reference.sh', + 't5605-clone-local.sh', + 't5606-clone-options.sh', + 't5607-clone-bundle.sh', + 't5608-clone-2gb.sh', + 't5609-clone-branch.sh', + 't5610-clone-detached.sh', + 't5611-clone-config.sh', + 't5612-clone-refspec.sh', + 't5613-info-alternate.sh', + 't5614-clone-submodules-shallow.sh', + 't5615-alternate-env.sh', + 't5616-partial-clone.sh', + 't5617-clone-submodules-remote.sh', + 't5618-alternate-refs.sh', + 't5619-clone-local-ambiguous-transport.sh', + 't5700-protocol-v1.sh', + 't5701-git-serve.sh', + 't5702-protocol-v2.sh', + 't5703-upload-pack-ref-in-want.sh', + 't5704-protocol-violations.sh', + 't5705-session-id-in-capabilities.sh', + 't5730-protocol-v2-bundle-uri-file.sh', + 't5731-protocol-v2-bundle-uri-git.sh', + 't5732-protocol-v2-bundle-uri-http.sh', + 't5750-bundle-uri-parse.sh', + 't5801-remote-helpers.sh', + 't5802-connect-helper.sh', + 't5810-proto-disable-local.sh', + 't5811-proto-disable-git.sh', + 't5812-proto-disable-http.sh', + 't5813-proto-disable-ssh.sh', + 't5814-proto-disable-ext.sh', + 't5815-submodule-protos.sh', + 't5900-repo-selection.sh', + 't6000-rev-list-misc.sh', + 't6001-rev-list-graft.sh', + 't6002-rev-list-bisect.sh', + 't6003-rev-list-topo-order.sh', + 't6004-rev-list-path-optim.sh', + 't6005-rev-list-count.sh', + 't6006-rev-list-format.sh', + 't6007-rev-list-cherry-pick-file.sh', + 't6008-rev-list-submodule.sh', + 't6009-rev-list-parent.sh', + 't6010-merge-base.sh', + 't6011-rev-list-with-bad-commit.sh', + 't6012-rev-list-simplify.sh', + 't6013-rev-list-reverse-parents.sh', + 't6014-rev-list-all.sh', + 't6016-rev-list-graph-simplify-history.sh', + 't6017-rev-list-stdin.sh', + 't6018-rev-list-glob.sh', + 't6019-rev-list-ancestry-path.sh', + 't6020-bundle-misc.sh', + 't6021-rev-list-exclude-hidden.sh', + 't6022-rev-list-missing.sh', + 't6030-bisect-porcelain.sh', + 't6040-tracking-info.sh', + 't6041-bisect-submodule.sh', + 't6050-replace.sh', + 't6060-merge-index.sh', + 't6100-rev-list-in-order.sh', + 't6101-rev-parse-parents.sh', + 't6102-rev-list-unexpected-objects.sh', + 't6110-rev-list-sparse.sh', + 't6111-rev-list-treesame.sh', + 't6112-rev-list-filters-objects.sh', + 't6113-rev-list-bitmap-filters.sh', + 't6114-keep-packs.sh', + 't6115-rev-list-du.sh', + 't6120-describe.sh', + 't6130-pathspec-noglob.sh', + 't6131-pathspec-icase.sh', + 't6132-pathspec-exclude.sh', + 't6133-pathspec-rev-dwim.sh', + 't6134-pathspec-in-submodule.sh', + 't6135-pathspec-with-attrs.sh', + 't6136-pathspec-in-bare.sh', + 't6200-fmt-merge-msg.sh', + 't6300-for-each-ref.sh', + 't6301-for-each-ref-errors.sh', + 't6302-for-each-ref-filter.sh', + 't6400-merge-df.sh', + 't6401-merge-criss-cross.sh', + 't6402-merge-rename.sh', + 't6403-merge-file.sh', + 't6404-recursive-merge.sh', + 't6405-merge-symlinks.sh', + 't6406-merge-attr.sh', + 't6407-merge-binary.sh', + 't6408-merge-up-to-date.sh', + 't6409-merge-subtree.sh', + 't6411-merge-filemode.sh', + 't6412-merge-large-rename.sh', + 't6413-merge-crlf.sh', + 't6414-merge-rename-nocruft.sh', + 't6415-merge-dir-to-symlink.sh', + 't6416-recursive-corner-cases.sh', + 't6417-merge-ours-theirs.sh', + 't6418-merge-text-auto.sh', + 't6419-merge-ignorecase.sh', + 't6421-merge-partial-clone.sh', + 't6422-merge-rename-corner-cases.sh', + 't6423-merge-rename-directories.sh', + 't6424-merge-unrelated-index-changes.sh', + 't6425-merge-rename-delete.sh', + 't6426-merge-skip-unneeded-updates.sh', + 't6427-diff3-conflict-markers.sh', + 't6428-merge-conflicts-sparse.sh', + 't6429-merge-sequence-rename-caching.sh', + 't6430-merge-recursive.sh', + 't6431-merge-criscross.sh', + 't6432-merge-recursive-space-options.sh', + 't6433-merge-toplevel.sh', + 't6434-merge-recursive-rename-options.sh', + 't6435-merge-sparse.sh', + 't6436-merge-overwrite.sh', + 't6437-submodule-merge.sh', + 't6438-submodule-directory-file-conflicts.sh', + 't6439-merge-co-error-msgs.sh', + 't6500-gc.sh', + 't6501-freshen-objects.sh', + 't6600-test-reach.sh', + 't6700-tree-depth.sh', + 't7001-mv.sh', + 't7002-mv-sparse-checkout.sh', + 't7003-filter-branch.sh', + 't7004-tag.sh', + 't7005-editor.sh', + 't7006-pager.sh', + 't7007-show.sh', + 't7008-filter-branch-null-sha1.sh', + 't7010-setup.sh', + 't7011-skip-worktree-reading.sh', + 't7012-skip-worktree-writing.sh', + 't7030-verify-tag.sh', + 't7031-verify-tag-signed-ssh.sh', + 't7060-wtstatus.sh', + 't7061-wtstatus-ignore.sh', + 't7062-wtstatus-ignorecase.sh', + 't7063-status-untracked-cache.sh', + 't7064-wtstatus-pv2.sh', + 't7101-reset-empty-subdirs.sh', + 't7102-reset.sh', + 't7103-reset-bare.sh', + 't7104-reset-hard.sh', + 't7105-reset-patch.sh', + 't7106-reset-unborn-branch.sh', + 't7107-reset-pathspec-file.sh', + 't7110-reset-merge.sh', + 't7111-reset-table.sh', + 't7112-reset-submodule.sh', + 't7113-post-index-change-hook.sh', + 't7201-co.sh', + 't7300-clean.sh', + 't7301-clean-interactive.sh', + 't7400-submodule-basic.sh', + 't7401-submodule-summary.sh', + 't7402-submodule-rebase.sh', + 't7403-submodule-sync.sh', + 't7406-submodule-update.sh', + 't7407-submodule-foreach.sh', + 't7408-submodule-reference.sh', + 't7409-submodule-detached-work-tree.sh', + 't7411-submodule-config.sh', + 't7412-submodule-absorbgitdirs.sh', + 't7413-submodule-is-active.sh', + 't7414-submodule-mistakes.sh', + 't7416-submodule-dash-url.sh', + 't7417-submodule-path-url.sh', + 't7418-submodule-sparse-gitmodules.sh', + 't7419-submodule-set-branch.sh', + 't7420-submodule-set-url.sh', + 't7421-submodule-summary-add.sh', + 't7422-submodule-output.sh', + 't7423-submodule-symlinks.sh', + 't7424-submodule-mixed-ref-formats.sh', + 't7450-bad-git-dotfiles.sh', + 't7500-commit-template-squash-signoff.sh', + 't7501-commit-basic-functionality.sh', + 't7502-commit-porcelain.sh', + 't7503-pre-commit-and-pre-merge-commit-hooks.sh', + 't7504-commit-msg-hook.sh', + 't7505-prepare-commit-msg-hook.sh', + 't7506-status-submodule.sh', + 't7507-commit-verbose.sh', + 't7508-status.sh', + 't7509-commit-authorship.sh', + 't7510-signed-commit.sh', + 't7511-status-index.sh', + 't7512-status-help.sh', + 't7513-interpret-trailers.sh', + 't7514-commit-patch.sh', + 't7515-status-symlinks.sh', + 't7516-commit-races.sh', + 't7517-per-repo-email.sh', + 't7518-ident-corner-cases.sh', + 't7519-status-fsmonitor.sh', + 't7520-ignored-hook-warning.sh', + 't7521-ignored-mode.sh', + 't7524-commit-summary.sh', + 't7525-status-rename.sh', + 't7526-commit-pathspec-file.sh', + 't7527-builtin-fsmonitor.sh', + 't7528-signed-commit-ssh.sh', + 't7600-merge.sh', + 't7601-merge-pull-config.sh', + 't7602-merge-octopus-many.sh', + 't7603-merge-reduce-heads.sh', + 't7604-merge-custom-message.sh', + 't7605-merge-resolve.sh', + 't7606-merge-custom.sh', + 't7607-merge-state.sh', + 't7608-merge-messages.sh', + 't7609-mergetool--lib.sh', + 't7610-mergetool.sh', + 't7611-merge-abort.sh', + 't7612-merge-verify-signatures.sh', + 't7614-merge-signoff.sh', + 't7615-diff-algo-with-mergy-operations.sh', + 't7700-repack.sh', + 't7701-repack-unpack-unreachable.sh', + 't7702-repack-cyclic-alternate.sh', + 't7703-repack-geometric.sh', + 't7704-repack-cruft.sh', + 't7800-difftool.sh', + 't7810-grep.sh', + 't7811-grep-open.sh', + 't7812-grep-icase-non-ascii.sh', + 't7813-grep-icase-iso.sh', + 't7814-grep-recurse-submodules.sh', + 't7815-grep-binary.sh', + 't7816-grep-binary-pattern.sh', + 't7817-grep-sparse-checkout.sh', + 't7900-maintenance.sh', + 't8001-annotate.sh', + 't8002-blame.sh', + 't8003-blame-corner-cases.sh', + 't8004-blame-with-conflicts.sh', + 't8005-blame-i18n.sh', + 't8006-blame-textconv.sh', + 't8007-cat-file-textconv.sh', + 't8008-blame-formats.sh', + 't8009-blame-vs-topicbranches.sh', + 't8010-cat-file-filters.sh', + 't8011-blame-split-file.sh', + 't8012-blame-colors.sh', + 't8013-blame-ignore-revs.sh', + 't8014-blame-ignore-fuzzy.sh', + 't9001-send-email.sh', + 't9002-column.sh', + 't9003-help-autocorrect.sh', + 't9100-git-svn-basic.sh', + 't9101-git-svn-props.sh', + 't9102-git-svn-deep-rmdir.sh', + 't9103-git-svn-tracked-directory-removed.sh', + 't9104-git-svn-follow-parent.sh', + 't9105-git-svn-commit-diff.sh', + 't9106-git-svn-commit-diff-clobber.sh', + 't9107-git-svn-migrate.sh', + 't9108-git-svn-glob.sh', + 't9109-git-svn-multi-glob.sh', + 't9110-git-svn-use-svm-props.sh', + 't9111-git-svn-use-svnsync-props.sh', + 't9112-git-svn-md5less-file.sh', + 't9113-git-svn-dcommit-new-file.sh', + 't9114-git-svn-dcommit-merge.sh', + 't9115-git-svn-dcommit-funky-renames.sh', + 't9116-git-svn-log.sh', + 't9117-git-svn-init-clone.sh', + 't9118-git-svn-funky-branch-names.sh', + 't9119-git-svn-info.sh', + 't9120-git-svn-clone-with-percent-escapes.sh', + 't9121-git-svn-fetch-renamed-dir.sh', + 't9122-git-svn-author.sh', + 't9123-git-svn-rebuild-with-rewriteroot.sh', + 't9124-git-svn-dcommit-auto-props.sh', + 't9125-git-svn-multi-glob-branch-names.sh', + 't9126-git-svn-follow-deleted-readded-directory.sh', + 't9127-git-svn-partial-rebuild.sh', + 't9128-git-svn-cmd-branch.sh', + 't9129-git-svn-i18n-commitencoding.sh', + 't9130-git-svn-authors-file.sh', + 't9131-git-svn-empty-symlink.sh', + 't9132-git-svn-broken-symlink.sh', + 't9133-git-svn-nested-git-repo.sh', + 't9134-git-svn-ignore-paths.sh', + 't9135-git-svn-moved-branch-empty-file.sh', + 't9136-git-svn-recreated-branch-empty-file.sh', + 't9137-git-svn-dcommit-clobber-series.sh', + 't9138-git-svn-authors-prog.sh', + 't9139-git-svn-non-utf8-commitencoding.sh', + 't9140-git-svn-reset.sh', + 't9141-git-svn-multiple-branches.sh', + 't9142-git-svn-shallow-clone.sh', + 't9143-git-svn-gc.sh', + 't9144-git-svn-old-rev_map.sh', + 't9145-git-svn-master-branch.sh', + 't9146-git-svn-empty-dirs.sh', + 't9147-git-svn-include-paths.sh', + 't9148-git-svn-propset.sh', + 't9150-svk-mergetickets.sh', + 't9151-svn-mergeinfo.sh', + 't9152-svn-empty-dirs-after-gc.sh', + 't9153-git-svn-rewrite-uuid.sh', + 't9154-git-svn-fancy-glob.sh', + 't9155-git-svn-fetch-deleted-tag.sh', + 't9156-git-svn-fetch-deleted-tag-2.sh', + 't9157-git-svn-fetch-merge.sh', + 't9158-git-svn-mergeinfo.sh', + 't9159-git-svn-no-parent-mergeinfo.sh', + 't9160-git-svn-preserve-empty-dirs.sh', + 't9161-git-svn-mergeinfo-push.sh', + 't9162-git-svn-dcommit-interactive.sh', + 't9163-git-svn-reset-clears-caches.sh', + 't9164-git-svn-dcommit-concurrent.sh', + 't9165-git-svn-fetch-merge-branch-of-branch.sh', + 't9166-git-svn-fetch-merge-branch-of-branch2.sh', + 't9167-git-svn-cmd-branch-subproject.sh', + 't9168-git-svn-partially-globbed-names.sh', + 't9169-git-svn-dcommit-crlf.sh', + 't9200-git-cvsexportcommit.sh', + 't9210-scalar.sh', + 't9211-scalar-clone.sh', + 't9300-fast-import.sh', + 't9301-fast-import-notes.sh', + 't9302-fast-import-unpack-limit.sh', + 't9303-fast-import-compression.sh', + 't9304-fast-import-marks.sh', + 't9350-fast-export.sh', + 't9351-fast-export-anonymize.sh', + 't9400-git-cvsserver-server.sh', + 't9401-git-cvsserver-crlf.sh', + 't9402-git-cvsserver-refs.sh', + 't9500-gitweb-standalone-no-errors.sh', + 't9501-gitweb-standalone-http-status.sh', + 't9502-gitweb-standalone-parse-output.sh', + 't9600-cvsimport.sh', + 't9601-cvsimport-vendor-branch.sh', + 't9602-cvsimport-branches-tags.sh', + 't9603-cvsimport-patchsets.sh', + 't9604-cvsimport-timestamps.sh', + 't9700-perl-git.sh', + 't9800-git-p4-basic.sh', + 't9801-git-p4-branch.sh', + 't9802-git-p4-filetype.sh', + 't9803-git-p4-shell-metachars.sh', + 't9804-git-p4-label.sh', + 't9805-git-p4-skip-submit-edit.sh', + 't9806-git-p4-options.sh', + 't9807-git-p4-submit.sh', + 't9808-git-p4-chdir.sh', + 't9809-git-p4-client-view.sh', + 't9810-git-p4-rcs.sh', + 't9811-git-p4-label-import.sh', + 't9812-git-p4-wildcards.sh', + 't9813-git-p4-preserve-users.sh', + 't9814-git-p4-rename.sh', + 't9815-git-p4-submit-fail.sh', + 't9816-git-p4-locked.sh', + 't9817-git-p4-exclude.sh', + 't9818-git-p4-block.sh', + 't9819-git-p4-case-folding.sh', + 't9820-git-p4-editor-handling.sh', + 't9821-git-p4-path-variations.sh', + 't9822-git-p4-path-encoding.sh', + 't9823-git-p4-mock-lfs.sh', + 't9824-git-p4-git-lfs.sh', + 't9825-git-p4-handle-utf16-without-bom.sh', + 't9826-git-p4-keep-empty-commits.sh', + 't9827-git-p4-change-filetype.sh', + 't9828-git-p4-map-user.sh', + 't9829-git-p4-jobs.sh', + 't9830-git-p4-symlink-dir.sh', + 't9831-git-p4-triggers.sh', + 't9832-unshelve.sh', + 't9833-errors.sh', + 't9834-git-p4-file-dir-bug.sh', + 't9835-git-p4-metadata-encoding-python2.sh', + 't9836-git-p4-metadata-encoding-python3.sh', + 't9850-shell.sh', + 't9901-git-web--browse.sh', + 't9902-completion.sh', + 't9903-bash-prompt.sh', +] + +# GIT_BUILD_DIR needs to be Unix-style without drive prefixes as it get added +# to the PATH variable. And given that drive prefixes contain a colon we'd +# otherwise end up with a broken PATH if we didn't convert it. +git_build_dir = meson.project_build_root() +if cygpath.found() + git_build_dir = run_command(cygpath, git_build_dir, check: true).stdout().strip() +endif + +foreach integration_test : integration_tests + test(fs.stem(integration_test), shell, + args: [ integration_test ], + workdir: meson.current_source_dir(), + env: { + 'GIT_BUILD_DIR': git_build_dir, + }, + depends: test_dependencies + bin_wrappers, + timeout: 0, + ) +endforeach diff --git a/templates/hooks/meson.build b/templates/hooks/meson.build new file mode 100644 index 0000000000..9bef5d7cfa --- /dev/null +++ b/templates/hooks/meson.build @@ -0,0 +1,24 @@ +hooks = [ + 'applypatch-msg.sample', + 'commit-msg.sample', + 'fsmonitor-watchman.sample', + 'post-update.sample', + 'pre-applypatch.sample', + 'pre-commit.sample', + 'pre-merge-commit.sample', + 'prepare-commit-msg.sample', + 'pre-push.sample', + 'pre-rebase.sample', + 'pre-receive.sample', + 'push-to-checkout.sample', + 'sendemail-validate.sample', + 'update.sample', +] + +foreach hook : hooks + configure_file( + input: hook, + output: hook, + configuration: script_sh_config, + ) +endforeach diff --git a/templates/info/meson.build b/templates/info/meson.build new file mode 100644 index 0000000000..4ee1cfdf89 --- /dev/null +++ b/templates/info/meson.build @@ -0,0 +1,5 @@ +configure_file( + input: 'exclude', + output: 'exclude', + configuration: script_sh_config, +) diff --git a/templates/meson.build b/templates/meson.build new file mode 100644 index 0000000000..7428aaf1e6 --- /dev/null +++ b/templates/meson.build @@ -0,0 +1,8 @@ +configure_file( + input: 'description', + output: 'description', + configuration: script_sh_config, +) + +subdir('hooks') +subdir('info')