From patchwork Fri Jan 24 15:02:44 2025 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: Arnd Bergmann X-Patchwork-Id: 13949539 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from bombadil.infradead.org (bombadil.infradead.org [198.137.202.133]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by smtp.lore.kernel.org (Postfix) with ESMTPS id 8941DC02181 for ; Fri, 24 Jan 2025 15:04:47 +0000 (UTC) DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed; d=lists.infradead.org; s=bombadil.20210309; h=Sender:List-Subscribe:List-Help :List-Post:List-Archive:List-Unsubscribe:List-Id:Content-Transfer-Encoding: Content-Type:Subject:References:In-Reply-To:Message-Id:Cc:To:From:Date: MIME-Version:Reply-To:Content-ID:Content-Description:Resent-Date:Resent-From: Resent-Sender:Resent-To:Resent-Cc:Resent-Message-ID:List-Owner; bh=LUh9um2eddIv6RoQa/yQugoax8kk1TNal/OqEBhRHG0=; b=G0GOKENrMDe4JT70d/ugCgGzFa PITfYmAVUp1wFoUv1X+3DjoPqW8Jn65jK0OlU9aoMY5AiL0Ke4mfiI0rm5WeUqzfopZ1HR+oqNs+e TOjJDtywQQT4CARToEHopMxv0hLAc1gCO/uYgy/GMijS2fU0fjKbIUuTjp3xeGFwqTyM/Awt8SueW jY2XezFeZnqJPPU+igRN+r7+WL1v3dPTkglzjreUIMWYW1qOqKnS06N+PCmrqO8Z0vP3+doZRGfqb +tjhRWH7DiPcjs+rGqo9DIjehO58lqkwGPPGx1IY8vtY2Du0pJTd0dixNkp1x2si5xlLCxGqtPiVr SGZam7xA==; Received: from localhost ([::1] helo=bombadil.infradead.org) by bombadil.infradead.org with esmtp (Exim 4.98 #2 (Red Hat Linux)) id 1tbLEU-0000000EuUe-2N0Z; Fri, 24 Jan 2025 15:04:30 +0000 Received: from fout-a2-smtp.messagingengine.com ([103.168.172.145]) by bombadil.infradead.org with esmtps (Exim 4.98 #2 (Red Hat Linux)) id 1tbLD9-0000000EuGd-0OAt for linux-arm-kernel@lists.infradead.org; Fri, 24 Jan 2025 15:03:08 +0000 Received: from phl-compute-10.internal (phl-compute-10.phl.internal [10.202.2.50]) by mailfout.phl.internal (Postfix) with ESMTP id A129413801A3; Fri, 24 Jan 2025 10:03:05 -0500 (EST) Received: from phl-imap-11 ([10.202.2.101]) by phl-compute-10.internal (MEProxy); Fri, 24 Jan 2025 10:03:05 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=arndb.de; h=cc :cc:content-transfer-encoding:content-type:content-type:date :date:from:from:in-reply-to:in-reply-to:message-id:mime-version :references:reply-to:subject:subject:to:to; s=fm2; t=1737730985; x=1737817385; bh=LUh9um2eddIv6RoQa/yQugoax8kk1TNal/OqEBhRHG0=; b= JYqUo7Fu6aCZFn9zAfN9uOiD2i5BeHmYVVE22PJlHgi3phhZ4p1hbZ94NyX/6c1R fsYEb7J0Yha2T5ahjOFf/21AZ3Z7oSabj6eBuUaIQu1bzTIPBO0F3Hnt+qCA0sek FALZWoNtiNepUZxR/OoxTNWdLgUpPBNxpRUL1lJSYPD8xmSOd5wOqFdIlaHEDFCz 5ESzEUI1mC/tCqN1w5sJ+CRP1Okpp/ybtKkwmbH8HO5LNdj4SMcIFSSnJT0wWyXl LoDgL6Qmy0DOYaH9fCroF3BdXA6vbILYgo/YPP1ErolekGcnr3kvSs/sWt3lhY/C oRrzalSE4fSUy/W0vNZ5GQ== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:cc:content-transfer-encoding :content-type:content-type:date:date:feedback-id:feedback-id :from:from:in-reply-to:in-reply-to:message-id:mime-version :references:reply-to:subject:subject:to:to:x-me-proxy :x-me-sender:x-me-sender:x-sasl-enc; s=fm3; t=1737730985; x= 1737817385; bh=LUh9um2eddIv6RoQa/yQugoax8kk1TNal/OqEBhRHG0=; b=D nY/p44H0GzO8ROQvJ6SvYyj+qUdkMuZQkbEBGuJtTu18wJci06lSqWjO4p1IK44g hiMrPRf8pPuZjyhzgeUY+qOkAQKpwM9r50l0eN3HHRGeYLsf2oKwmspBZ4kjdkIh 0jIFgoMxfD+o07hRFwbreY0o3WMTwxbvAeaoCxmG1kHiD2oTdehXcrFh94C3kHGV yDpI3OUDwWq0/t0LqRTn5huXyXEJXt+bwzPKAw+JWvbLtvFJD5aRTX9FggThJVWV zePMfqQwIJ5idxEXjUcIvdOJPOOHWU/xoHPhmNJ/N/6R2UDCBmkl/1gXO/7jIGJC aWbQn0L9jWGpX/py0GJ6Q== X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeefuddrudejgedggeekvdcutefuodetggdotefrod ftvfcurfhrohhfihhlvgemucfhrghsthforghilhdpggftfghnshhusghstghrihgsvgdp uffrtefokffrpgfnqfghnecuuegrihhlohhuthemuceftddtnecusecvtfgvtghiphhivg hnthhsucdlqddutddtmdenucfjughrpefoggffhffvvefkjghfufgtgfesthejredtredt tdenucfhrhhomhepfdetrhhnugcuuegvrhhgmhgrnhhnfdcuoegrrhhnugesrghrnhgusg druggvqeenucggtffrrghtthgvrhhnpeefhfehteffuddvgfeigefhjeetvdekteekjeef keekleffjeetvedvgefhhfeihfenucffohhmrghinhepkhgvrhhnvghlrdhorhhgnecuve hluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehmrghilhhfrhhomheprghrnhgusegr rhhnuggsrdguvgdpnhgspghrtghpthhtohepgedpmhhouggvpehsmhhtphhouhhtpdhrtg hpthhtohepthhorhhvrghlughssehlihhnuhigqdhfohhunhgurghtihhonhdrohhrghdp rhgtphhtthhopehlihhnuhigqdgrrhhmqdhkvghrnhgvlheslhhishhtshdrihhnfhhrrg guvggrugdrohhrghdprhgtphhtthhopehsohgtsehlihhsthhsrdhlihhnuhigrdguvghv pdhrtghpthhtoheplhhinhhugidqkhgvrhhnvghlsehvghgvrhdrkhgvrhhnvghlrdhorh hg X-ME-Proxy: Feedback-ID: i56a14606:Fastmail Received: by mailuser.phl.internal (Postfix, from userid 501) id 1E3382220075; Fri, 24 Jan 2025 10:03:05 -0500 (EST) X-Mailer: MessagingEngine.com Webmail Interface MIME-Version: 1.0 Date: Fri, 24 Jan 2025 16:02:44 +0100 From: "Arnd Bergmann" To: "Linus Torvalds" Cc: linux-kernel@vger.kernel.org, linux-arm-kernel@lists.infradead.org, soc@lists.linux.dev Message-Id: In-Reply-To: <1f0939fd-1694-476e-954f-e58ff8650dd9@app.fastmail.com> References: <1f0939fd-1694-476e-954f-e58ff8650dd9@app.fastmail.com> Subject: [GIT PULL 1/5] soc: arm platform code for 6.14 X-CRM114-Version: 20100106-BlameMichelson ( TRE 0.8.0 (BSD) ) MR-646709E3 X-CRM114-CacheID: sfid-20250124_070307_208497_05896795 X-CRM114-Status: UNSURE ( 8.52 ) X-CRM114-Notice: Please train this message. X-BeenThere: linux-arm-kernel@lists.infradead.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Sender: "linux-arm-kernel" Errors-To: linux-arm-kernel-bounces+linux-arm-kernel=archiver.kernel.org@lists.infradead.org The following changes since commit fac04efc5c793dccbd07e2d59af9f90b7fc0dca4: Linux 6.13-rc2 (2024-12-08 14:03:39 -0800) are available in the Git repository at: https://git.kernel.org/pub/scm/linux/kernel/git/soc/soc.git tags/soc-arm-6.14 for you to fetch changes up to 2fd7a3f27892f1ca4fca24591a7a82fd0437e080: Merge tag 'at91-soc-6.14' of https://git.kernel.org/pub/scm/linux/kernel/git/at91/linux into soc/arm (2025-01-17 12:57:00 +0100) ---------------------------------------------------------------- soc: arm platform code for 6.14 The updates here add code for the Microchip SAMA7D65 SoC, as well as minor bugfixes for OMAP. ---------------------------------------------------------------- Aaro Koskinen (1): ARM: omap1: Fix up the Retu IRQ on Nokia 770 Andreas Kemnade (1): ARM: omap2plus_defconfig: enable charger of TWL603X Arnd Bergmann (2): Merge tag 'omap-for-v6.14/soc-signed' of https://git.kernel.org/pub/scm/linux/kernel/git/khilman/linux-omap into soc/arm Merge tag 'at91-soc-6.14' of https://git.kernel.org/pub/scm/linux/kernel/git/at91/linux into soc/arm Christophe JAILLET (1): ARM: OMAP2+: Fix a typo Javier Carrasco (1): soc: atmel: fix device_node release in atmel_soc_device_init() Nicolas Ferre (1): ARM: at91: pm: change BU Power Switch to automatic mode Ryan Wanner (1): ARM: at91: add new SoC sama7d65 arch/arm/configs/omap2plus_defconfig | 1 + arch/arm/mach-at91/Kconfig | 11 +++++++++++ arch/arm/mach-at91/pm.c | 31 ++++++++++++++++++++----------- arch/arm/mach-omap1/board-nokia770.c | 2 +- arch/arm/mach-omap2/powerdomain.c | 2 +- drivers/soc/atmel/soc.c | 2 +- 6 files changed, 35 insertions(+), 14 deletions(-) From patchwork Fri Jan 24 15:03:28 2025 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: Arnd Bergmann X-Patchwork-Id: 13949540 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from bombadil.infradead.org (bombadil.infradead.org [198.137.202.133]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by smtp.lore.kernel.org (Postfix) with ESMTPS id CCD22C02181 for ; Fri, 24 Jan 2025 15:06:05 +0000 (UTC) DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed; d=lists.infradead.org; s=bombadil.20210309; h=Sender:List-Subscribe:List-Help :List-Post:List-Archive:List-Unsubscribe:List-Id:Content-Transfer-Encoding: Content-Type:Subject:References:In-Reply-To:Message-Id:Cc:To:From:Date: MIME-Version:Reply-To:Content-ID:Content-Description:Resent-Date:Resent-From: Resent-Sender:Resent-To:Resent-Cc:Resent-Message-ID:List-Owner; bh=cuv154PFa+Or4Xs/jn6LudX1tt8F7elcDG9gWdvfHYw=; b=cxvmAr6RW7GasHcXDAviQO3Q1G sQ7c32koFtrCungfTVBcDVX2UFTw4dGY5bSGcHlnc39ISQONC97YKuWHX/mCHGV7xjvLbf3IdN70L 9jKq2lNLBBdoXOxBIpH38g5RASyYtP9+4sCf4doiqE6mvVGx5y8zPq85Ue08BYWWbv3e1dF2682yy C22MlvyXF1CCIck7eQcF37/0bQpkbSUpGlooARg6eMB2tYJ7RBROUuwrkSoOMYdAED2/JdttgqXAt T+Pi9aPRXs7cmbihc1TR8CTsEL1KFnrCsfXk3UcGdOiujhW7hMXhOgguUGMU1BpTPjfBXZhMJveKv IOqLYxWw==; Received: from localhost ([::1] helo=bombadil.infradead.org) by bombadil.infradead.org with esmtp (Exim 4.98 #2 (Red Hat Linux)) id 1tbLFn-0000000Euni-2OX5; Fri, 24 Jan 2025 15:05:51 +0000 Received: from fhigh-a6-smtp.messagingengine.com ([103.168.172.157]) by bombadil.infradead.org with esmtps (Exim 4.98 #2 (Red Hat Linux)) id 1tbLE1-0000000EuOa-1rpr for linux-arm-kernel@lists.infradead.org; Fri, 24 Jan 2025 15:04:02 +0000 Received: from phl-compute-10.internal (phl-compute-10.phl.internal [10.202.2.50]) by mailfhigh.phl.internal (Postfix) with ESMTP id C73DA114019F; Fri, 24 Jan 2025 10:04:00 -0500 (EST) Received: from phl-imap-11 ([10.202.2.101]) by phl-compute-10.internal (MEProxy); Fri, 24 Jan 2025 10:04:00 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=arndb.de; h=cc :cc:content-transfer-encoding:content-type:content-type:date :date:from:from:in-reply-to:in-reply-to:message-id:mime-version :references:reply-to:subject:subject:to:to; s=fm2; t=1737731040; x=1737817440; bh=cuv154PFa+Or4Xs/jn6LudX1tt8F7elcDG9gWdvfHYw=; b= lBbw9g5weWLsSg8HC8x2+yGg/Kud3X+F9AwakZ1eB897uUlJSD0heLLTLZA9WuNv KLro/hD48DPLKWafr2rZCMjfyrAFYo21pHRAttqeH6f5yIHHiS3Y1ZjB1aNKXtIN DVCD/tDLSc+bJAweEjRIGlcTDFSQLUSAIMg2l4SMr5OSzfgbbLVdZcLDJ+NBP/GB mjmpMeJ7lQ5rp/H31EO2tVuktFZ1wdqO54paDX8Pkvj4wVnGeXw+LvfXPhEs+c0L D7dTzi/Do1IEBNKkYsMjuzshM1nSwuFd5VGbbiVy67YeRgxqtqhMO+2NbuGhbccr vgWpASxyoqrG0urqpGUw/w== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:cc:content-transfer-encoding :content-type:content-type:date:date:feedback-id:feedback-id :from:from:in-reply-to:in-reply-to:message-id:mime-version :references:reply-to:subject:subject:to:to:x-me-proxy :x-me-sender:x-me-sender:x-sasl-enc; s=fm3; t=1737731040; x= 1737817440; bh=cuv154PFa+Or4Xs/jn6LudX1tt8F7elcDG9gWdvfHYw=; b=H sVnubIzChW+3LwFxrF/AvLx1662Blj9/ibPKeFUj0bEjmgW1d7qAV1cNQpCoe/gu Rx3So8zwEWkDouu+hVI+nVpCOF4nSA0XpB2Ynv/g6EZBT5CYf0/VzbpbVKiOhsNr chDpV/4toXUn5RYEtfNXBZ0LbS0ylUXjNSsslPuLmP0fPY2BSpRtPXyl/w/escy6 qMn7bRrZfUR06fGTBIXxUqvL3atogyVgN/Bq4wvtBTiXDkIGEM6zSBI7G3AqhiFL tfoHi0zMfJIv8gNayMDXmI9xvEaUt3FXKpvh+F8UbyJcu9RF76siq4iJuZP7lHS5 KNVTGuVw7epnXi5Jf97Nw== X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeefuddrudejgedggeekvdcutefuodetggdotefrod ftvfcurfhrohhfihhlvgemucfhrghsthforghilhdpggftfghnshhusghstghrihgsvgdp uffrtefokffrpgfnqfghnecuuegrihhlohhuthemuceftddtnecusecvtfgvtghiphhivg hnthhsucdlqddutddtmdenucfjughrpefoggffhffvvefkjghfufgtgfesthejredtredt tdenucfhrhhomhepfdetrhhnugcuuegvrhhgmhgrnhhnfdcuoegrrhhnugesrghrnhgusg druggvqeenucggtffrrghtthgvrhhnpeefffelleduheehleejtdfhheegtdffhedtffei leehkeetffevtdegheduhfeiudenucffohhmrghinhepkhgvrhhnvghlrdhorhhgpdhgih hthhhusgdrtghomhenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepmhgrihhl fhhrohhmpegrrhhnugesrghrnhgusgdruggvpdhnsggprhgtphhtthhopeegpdhmohguvg epshhmthhpohhuthdprhgtphhtthhopehtohhrvhgrlhgusheslhhinhhugidqfhhouhhn uggrthhiohhnrdhorhhgpdhrtghpthhtoheplhhinhhugidqrghrmhdqkhgvrhhnvghlse hlihhsthhsrdhinhhfrhgruggvrggurdhorhhgpdhrtghpthhtohepshhotgeslhhishht shdrlhhinhhugidruggvvhdprhgtphhtthhopehlihhnuhigqdhkvghrnhgvlhesvhhgvg hrrdhkvghrnhgvlhdrohhrgh X-ME-Proxy: Feedback-ID: i56a14606:Fastmail Received: by mailuser.phl.internal (Postfix, from userid 501) id 7401C2220075; Fri, 24 Jan 2025 10:04:00 -0500 (EST) X-Mailer: MessagingEngine.com Webmail Interface MIME-Version: 1.0 Date: Fri, 24 Jan 2025 16:03:28 +0100 From: "Arnd Bergmann" To: "Linus Torvalds" Cc: linux-kernel@vger.kernel.org, linux-arm-kernel@lists.infradead.org, soc@lists.linux.dev Message-Id: In-Reply-To: <1f0939fd-1694-476e-954f-e58ff8650dd9@app.fastmail.com> References: <1f0939fd-1694-476e-954f-e58ff8650dd9@app.fastmail.com> Subject: [GIT PULL 2/5] soc: new SoC support for 6.14 X-CRM114-Version: 20100106-BlameMichelson ( TRE 0.8.0 (BSD) ) MR-646709E3 X-CRM114-CacheID: sfid-20250124_070401_563512_376F5706 X-CRM114-Status: GOOD ( 13.76 ) X-BeenThere: linux-arm-kernel@lists.infradead.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Sender: "linux-arm-kernel" Errors-To: linux-arm-kernel-bounces+linux-arm-kernel=archiver.kernel.org@lists.infradead.org The following changes since commit fac04efc5c793dccbd07e2d59af9f90b7fc0dca4: Linux 6.13-rc2 (2024-12-08 14:03:39 -0800) are available in the Git repository at: https://git.kernel.org/pub/scm/linux/kernel/git/soc/soc.git tags/soc-new-6.14 for you to fetch changes up to 0bcf3ac14626f1c174c262834656603769579497: Merge tag 'spacemit-dt-for-6.14-1' of https://github.com/spacemit-com/linux into soc/newsoc (2025-01-23 17:36:29 +0100) ---------------------------------------------------------------- soc: new SoC support for 6.14 Two new SoC families are added here, with devicetree files and a little bit of infrastructure to allow booting: - Blaize BLZP1600 is an AI chip using custom GSP (Graph Streaming Processor) cores for computation, and two small Cortex-A53 cores that run the operating system. - SpacemiT K1 is a 64-bit RISC-V chip, using eight custom RVA22 compatible CPU cores with vector support. Also marketed at AI applications, it has a much slower NPU compared to BLZP1600, but in turn focuses on the CPU performance ---------------------------------------------------------------- Arnd Bergmann (1): Merge tag 'spacemit-dt-for-6.14-1' of https://github.com/spacemit-com/linux into soc/newsoc Nikolaos Pasaloukos (6): dt-bindings: Add Blaize vendor prefix dt-bindings: arm: blaize: Add Blaize BLZP1600 SoC arm64: Add Blaize BLZP1600 SoC family arm64: dts: Add initial support for Blaize BLZP1600 CB2 arm64: defconfig: Enable Blaize BLZP1600 platform MAINTAINER: Add entry for Blaize SoC Yangyu Chen (8): dt-bindings: riscv: Add SpacemiT X60 compatibles dt-bindings: riscv: add SpacemiT K1 bindings dt-bindings: timer: Add SpacemiT K1 CLINT dt-bindings: interrupt-controller: Add SpacemiT K1 PLIC riscv: add SpacemiT SoC family Kconfig support riscv: dts: add initial SpacemiT K1 SoC device tree riscv: dts: spacemit: add Banana Pi BPI-F3 board device tree riscv: defconfig: enable SpacemiT SoC Yixun Lan (4): MAINTAINERS: setup support for SpacemiT SoC tree dt-bindings: serial: 8250: Add SpacemiT K1 uart compatible riscv: dts: spacemit: add pinctrl property to uart0 in BPI-F3 riscv: dts: spacemit: move aliases to board dts Documentation/devicetree/bindings/arm/blaize.yaml | 40 ++ .../interrupt-controller/sifive,plic-1.0.0.yaml | 1 + Documentation/devicetree/bindings/riscv/cpus.yaml | 1 + .../devicetree/bindings/riscv/spacemit.yaml | 28 ++ Documentation/devicetree/bindings/serial/8250.yaml | 4 +- .../devicetree/bindings/timer/sifive,clint.yaml | 1 + .../devicetree/bindings/vendor-prefixes.yaml | 2 + MAINTAINERS | 18 + arch/arm64/Kconfig.platforms | 5 + arch/arm64/boot/dts/Makefile | 1 + arch/arm64/boot/dts/blaize/Makefile | 2 + arch/arm64/boot/dts/blaize/blaize-blzp1600-cb2.dts | 83 ++++ .../arm64/boot/dts/blaize/blaize-blzp1600-som.dtsi | 23 ++ arch/arm64/boot/dts/blaize/blaize-blzp1600.dtsi | 205 ++++++++++ arch/arm64/configs/defconfig | 1 + arch/riscv/Kconfig.socs | 5 + arch/riscv/boot/dts/Makefile | 1 + arch/riscv/boot/dts/spacemit/Makefile | 2 + arch/riscv/boot/dts/spacemit/k1-bananapi-f3.dts | 26 ++ arch/riscv/boot/dts/spacemit/k1-pinctrl.dtsi | 20 + arch/riscv/boot/dts/spacemit/k1.dtsi | 452 +++++++++++++++++++++ arch/riscv/configs/defconfig | 1 + 22 files changed, 921 insertions(+), 1 deletion(-) create mode 100644 Documentation/devicetree/bindings/arm/blaize.yaml create mode 100644 Documentation/devicetree/bindings/riscv/spacemit.yaml create mode 100644 arch/arm64/boot/dts/blaize/Makefile create mode 100644 arch/arm64/boot/dts/blaize/blaize-blzp1600-cb2.dts create mode 100644 arch/arm64/boot/dts/blaize/blaize-blzp1600-som.dtsi create mode 100644 arch/arm64/boot/dts/blaize/blaize-blzp1600.dtsi create mode 100644 arch/riscv/boot/dts/spacemit/Makefile create mode 100644 arch/riscv/boot/dts/spacemit/k1-bananapi-f3.dts create mode 100644 arch/riscv/boot/dts/spacemit/k1-pinctrl.dtsi create mode 100644 arch/riscv/boot/dts/spacemit/k1.dtsi From patchwork Fri Jan 24 15:06:32 2025 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 8bit X-Patchwork-Submitter: Arnd Bergmann X-Patchwork-Id: 13949541 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from bombadil.infradead.org (bombadil.infradead.org [198.137.202.133]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by smtp.lore.kernel.org (Postfix) with ESMTPS id 721B3C02181 for ; Fri, 24 Jan 2025 15:09:24 +0000 (UTC) DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed; d=lists.infradead.org; s=bombadil.20210309; h=Sender:List-Subscribe:List-Help :List-Post:List-Archive:List-Unsubscribe:List-Id:Content-Transfer-Encoding: Content-Type:Subject:References:In-Reply-To:Message-Id:Cc:To:From:Date: MIME-Version:Reply-To:Content-ID:Content-Description:Resent-Date:Resent-From: Resent-Sender:Resent-To:Resent-Cc:Resent-Message-ID:List-Owner; bh=rM9tiD+4rKvwlOIunKsBA7l55MBlXo6xxul+SEmYYgU=; b=NkCdVtcLZoiNWOExSiQhTCEenh 1WXRD7XTrTAKzZgRyqEYqXmb9EMsNMn8DFOeBAVCubZCB5EdA+7MmNb6XHIKJXzO/iPTcnGQqnZxo UQ2bpwAM6L6B1kyKLDp/Nwe3him4o/q8R3E0gGygyKnFB10NeejAiNh83Zap1pykxaIFMJUs8R2Ry PGZNR8XW6XrJQnrDfpM/DPJiWaM2+F+12R7uo/n5Nv4Ay5X5kR/SPBh2h+if00OmA35txsiWqZf9r uJa7c9KV7JEpYeSokoBgFwAoOAsIV9GmQvyOb314Sq7ploa5WmFukGjugLWPiuwPS0itptGIkrc2c Q8LlopYQ==; Received: from localhost ([::1] helo=bombadil.infradead.org) by bombadil.infradead.org with esmtp (Exim 4.98 #2 (Red Hat Linux)) id 1tbLIv-0000000EvB0-23tt; Fri, 24 Jan 2025 15:09:05 +0000 Received: from fhigh-a6-smtp.messagingengine.com ([103.168.172.157]) by bombadil.infradead.org with esmtps (Exim 4.98 #2 (Red Hat Linux)) id 1tbLHa-0000000Ev3a-2FYB for linux-arm-kernel@lists.infradead.org; Fri, 24 Jan 2025 15:07:45 +0000 Received: from phl-compute-10.internal (phl-compute-10.phl.internal [10.202.2.50]) by mailfhigh.phl.internal (Postfix) with ESMTP id 97D4511400BC; Fri, 24 Jan 2025 10:07:41 -0500 (EST) Received: from phl-imap-11 ([10.202.2.101]) by phl-compute-10.internal (MEProxy); Fri, 24 Jan 2025 10:07:41 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=arndb.de; h=cc :cc:content-transfer-encoding:content-type:content-type:date :date:from:from:in-reply-to:in-reply-to:message-id:mime-version :references:reply-to:subject:subject:to:to; s=fm2; t=1737731261; x=1737817661; bh=rM9tiD+4rKvwlOIunKsBA7l55MBlXo6xxul+SEmYYgU=; b= QFB3daLpiyHCwVB/83eXE02SWOY++amOv5iCQXjWzCqmR+Q57X8Q43nau9gDFP+L 2HlAmsDrBcC7/Kna04xX/vsUlkmojGLqnV6pcb0/VIeuIugPHHg09S09qUS0+fj0 IsJNGx8auXs1QKsOLRS/uiIQyJ4VZchKTFhLM28j79YTQJqR1RuWe4YBRBNhcx6h kEQ64OYMbUBNu+Np7zitZTW2oFcnXu+DFQK9gDCEd+M+lJOWUnJZpBy/fMrRH/WM FzuqkvYf8xMs+sk5n68vMNHgvEPXfQqNUovHw97L5cdEQ22UfP1H48nUqdD2jc02 sE/HLAShntPHBZncbxxIHA== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:cc:content-transfer-encoding :content-type:content-type:date:date:feedback-id:feedback-id :from:from:in-reply-to:in-reply-to:message-id:mime-version :references:reply-to:subject:subject:to:to:x-me-proxy :x-me-sender:x-me-sender:x-sasl-enc; s=fm3; t=1737731261; x= 1737817661; bh=rM9tiD+4rKvwlOIunKsBA7l55MBlXo6xxul+SEmYYgU=; b=J xRcSdyn5EV+NfWa+Puw+HyCgVbPqiTou3V192eTqCR15wRfQK88Hxv6A/Md7qlDN wXvcSBbxxAaayKlWY7uGeUQjlNhh6IrjO1Px5N98SzyimK4xA2sL5Q5ChQWrlvVc q8280N6Y+lzcejVDAEBSeHoqWRiyUlDWhtHefhrufVBVcj+mm19XYPGtwmmGOX6m 0kRyJ6qQ2Q+jWW4wrOSHaDS6e034VhvaRSbBI9prS9s2qH2e8FH1pJadVbk7FtUG ruHx/mg4kXXAvni5c/MFOK7mNK0IwgFqTYZUXe8o5S8Yf007nBvXBS2wUxYm5o2P Gq4fF5U7kNrZi2DfJdC8Q== X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeefuddrudejgedggeekfecutefuodetggdotefrod ftvfcurfhrohhfihhlvgemucfhrghsthforghilhdpggftfghnshhusghstghrihgsvgdp uffrtefokffrpgfnqfghnecuuegrihhlohhuthemuceftddtnecusecvtfgvtghiphhivg hnthhsucdlqddutddtmdenucfjughrpefoggffhffvvefkjghfufgtgfesthhqredtredt jeenucfhrhhomhepfdetrhhnugcuuegvrhhgmhgrnhhnfdcuoegrrhhnugesrghrnhgusg druggvqeenucggtffrrghtthgvrhhnpeefueegkeffveeugeehieehiedukeegfefhffeu tdettdffteeluefhheetkeekvdenucffohhmrghinhepkhgvrhhnvghlrdhorhhgpdhgih hthhhusgdrtghomhenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepmhgrihhl fhhrohhmpegrrhhnugesrghrnhgusgdruggvpdhnsggprhgtphhtthhopeegpdhmohguvg epshhmthhpohhuthdprhgtphhtthhopehtohhrvhgrlhgusheslhhinhhugidqfhhouhhn uggrthhiohhnrdhorhhgpdhrtghpthhtoheplhhinhhugidqrghrmhdqkhgvrhhnvghlse hlihhsthhsrdhinhhfrhgruggvrggurdhorhhgpdhrtghpthhtohepshhotgeslhhishht shdrlhhinhhugidruggvvhdprhgtphhtthhopehlihhnuhigqdhkvghrnhgvlhesvhhgvg hrrdhkvghrnhgvlhdrohhrgh X-ME-Proxy: Feedback-ID: i56a14606:Fastmail Received: by mailuser.phl.internal (Postfix, from userid 501) id 29F5E2220071; Fri, 24 Jan 2025 10:07:41 -0500 (EST) X-Mailer: MessagingEngine.com Webmail Interface MIME-Version: 1.0 Date: Fri, 24 Jan 2025 16:06:32 +0100 From: "Arnd Bergmann" To: "Linus Torvalds" Cc: linux-kernel@vger.kernel.org, linux-arm-kernel@lists.infradead.org, soc@lists.linux.dev Message-Id: In-Reply-To: <1f0939fd-1694-476e-954f-e58ff8650dd9@app.fastmail.com> References: <1f0939fd-1694-476e-954f-e58ff8650dd9@app.fastmail.com> Subject: [GIT PULL 3/5] soc: devicetree changes for 6.14 X-CRM114-Version: 20100106-BlameMichelson ( TRE 0.8.0 (BSD) ) MR-646709E3 X-CRM114-CacheID: sfid-20250124_070742_827888_0BB7BA90 X-CRM114-Status: GOOD ( 13.55 ) X-BeenThere: linux-arm-kernel@lists.infradead.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Sender: "linux-arm-kernel" Errors-To: linux-arm-kernel-bounces+linux-arm-kernel=archiver.kernel.org@lists.infradead.org The following changes since commit fac04efc5c793dccbd07e2d59af9f90b7fc0dca4: Linux 6.13-rc2 (2024-12-08 14:03:39 -0800) are available in the Git repository at: https://git.kernel.org/pub/scm/linux/kernel/git/soc/soc.git tags/soc-dt-6.14 for you to fetch changes up to 3c9690f76d66f45f727e00c838faba9a3ef4e295: Merge tag 'aspeed-6.14-devicetree' of https://git.kernel.org/pub/scm/linux/kernel/git/joel/bmc into soc/dt (2025-01-23 17:39:26 +0100) ---------------------------------------------------------------- soc: devicetree changes for 6.14 We see the addition of eleven new SoCs, including a total of sixx arm64 chips from Qualcomm alone. Overall, the Qualcomm platforms once again make up the majority of all changes, after a couple of quieter releases. The new SoCs in this branch are: - Microchip sama7d65 is a new 32-bit embedded chip with a single Cortex-A7 and the current high end of the old Atmel SoC line. - Samsung Exynos 9810 is a mobile phone chip used in some older phones like the Samsung Galaxy S9 - Renesas R-Car V4H ES3.0 (R8A779G3) is an updated version of the V4H (R8A779G0) low-power automotive SoC - Renesas RZ/G3E (R0A09G047) is a family of embedded chips using Cortex-A55 cores - Qualcomm Snapdragon 8 Elite (SM8750) is a new phone chip based on Qualcomm's Oryon CPU cores. - Qualcomm Snapdragon AR2 (SAR2130P) is a SoC for augmented reality glasses. - Qualcomm IQ6 (QCS610) and IQ8 (QCS8300) are two industrial IOT platforms. - Snapdragon 425 (MSM8917) is a mobile phone SoC from 2016 - Qualcomm IPQ5424 is a Wi-Fi 7 networking chip All of the above are part of already supported SoC families that only need new devicetree files. Two additional SoCs in new families are part of a separate branch. There are 48 new machines in total, including six arm32 ones based on aspeed. broadcom, microchip and st SoCs all using Cortex-A7 cores, and a single risc-v board, the Banana Pi R3. The remaining ones use arm64 chips from Broadcom, Samsung, NXP, Mediatek, Qualcomm, Renesas and Rockchips and cover development boards, phones, laptops, industrial machines routers. A lot of ongoing work is for cleaning up build time warnings and other issues, in addition to the new machines and added features. ---------------------------------------------------------------- Abel Vesa (7): arm64: dts: qcom: x1e80100: Describe the SDHC controllers arm64: dts: qcom: x1e80100-qcp: Enable SD card support arm64: dts: qcom: x1e78100-t14s: Enable support for both Type-A USB ports arm64: dts: qcom: x1e78100-qcp: Enable Type-A USB ports labeled 3 and 4/6 arm64: dts: qcom: x1e80100: Fix interconnect tags for SDHC nodes arm64: dts: qcom: x1e78100-t14s: Enable fingerprint reader arm64: dts: qcom: x1e80100: Fix usb_2 controller interrupts Akhil R (1): arm64: tegra: Fix DMA ID for SPI2 Alain Volmat (5): arm64: dts: st: add csi & dcmipp node in stm32mp25 arm64: dts: st: enable imx335/csi/dcmipp pipeline on stm32mp257f-ev1 dt-bindings: gpu: mali-utgard: Add st,stih410-mali compatible ARM: dts: st: add node for the MALI gpu on stih410.dtsi ARM: dts: st: enable the MALI gpu on the stih410-b2260 Aleksandrs Vinarskis (1): arm64: dts: qcom: x1e80100-dell-xps13-9345: Introduce retimer support Alexander Stein (7): ARM: dts: imx7-mba7: remove LVDS transmitter regulator ARM: dts: imx7-tqma7: Remove superfluous status="okay" property ARM: dts: imx7-tqma7: add missing vs-supply for LM75A (rev. 01xxx) ARM: dts: imx7-mba7: Add 3.3V and 5.0V regulators ARM: dts: imx7-mba7: Fix SD card vmmc-supply ARM: dts: imx7-mba7: Remove duplicated power supply ARM: dts: imx7[d]-mba7: add Ethernet PHY IRQ support Alexey Charkov (2): dt-bindings: arm: rockchip: Add H96 Max V58 TV box arm64: dts: rockchip: Add H96 Max V58 TV Box based on RK3588 SoC Alexey Klimov (4): arm64: dts: qcom: sm6115: add apr and its services arm64: dts: qcom: sm6115: add LPASS LPI pin controller arm64: dts: qcom: sm4250: add LPASS LPI pin controller arm64: dts: qcom: qrb4210-rb2: add HDMI audio playback support Andre Przywara (1): arm64: dts: allwinner: h313: enable DVFS for Tanix TX1 Andreas Kemnade (2): ARM: dts: ti/omap: gta04: fix pm issues caused by spi module ARM: dts: ti/omap: omap3-gta04: use proper touchscreen properties Andrew Davis (3): arm64: dts: ti: k3-am625-sk: Remove M4 mailbox node redefinition arm64: dts: ti: k3-am62p: Enable Mailbox nodes at the board level arm64: dts: ti: k3-am67a-beagley-ai: Add remote processor nodes Andrew Halaney (2): arm64: dts: ti: k3-j784s4-evm: Mark tps659413 regulators as bootph-all arm64: dts: ti: k3-am69-sk: Mark tps659413 regulators as bootph-all André Draszik (5): MAINTAINERS: add myself and Tudor as reviewers for Google Tensor SoC arm64: dts: exynos: gs101: phy region for exynos5-usbdrd is larger arm64: dts: exynos: gs101: allow stable USB phy Vbus detection arm64: dts: exynos: gs101-oriole: enable Maxim max77759 TCPCi arm64: dts: exynos: gs101-oriole: add pd-disable and typec-power-opmode Andy Yan (1): dt-bindings: soc: rockchip: add rk3576 hdptxphy grf syscon Anthony Ruhier (1): arm64: dts: qcom: x1e80100-lenovo-yoga-slim7x: Add lid switch Anton Kirilov (1): arm64: dts: rockchip: Enable the USB 3.0 port on NanoPi R6C/R6S Anurag Dutta (2): arm64: dts: ti: k3-j784s4: Fix clock IDs for MCSPI instances arm64: dts: ti: k3-j7200: Add node to disable loopback connection Arnaud Pouliquen (1): ARM: dts: stm32: Fix IPCC EXTI declaration on stm32mp151 Arnd Bergmann (34): Merge tag 'stm32-dt-for-v6.14-1' of https://git.kernel.org/pub/scm/linux/kernel/git/atorgue/stm32 into soc/dt Merge tag 'renesas-dts-for-v6.14-tag1' of https://git.kernel.org/pub/scm/linux/kernel/git/geert/renesas-devel into soc/dt Merge tag 'samsung-dt-6.14' of https://git.kernel.org/pub/scm/linux/kernel/git/krzk/linux into soc/dt Merge tag 'thead-dt-for-v6.14' of https://github.com/pdp7/linux into soc/dt Merge tag 'samsung-dt64-6.14' of https://git.kernel.org/pub/scm/linux/kernel/git/krzk/linux into soc/dt Merge tag 'dt64-cleanup-6.14' of https://git.kernel.org/pub/scm/linux/kernel/git/krzk/linux-dt into soc/dt Merge tag 'dt-cleanup-6.14' of https://git.kernel.org/pub/scm/linux/kernel/git/krzk/linux-dt into soc/dt Merge tag 'hisi-arm64-dt-for-6.14' of https://github.com/hisilicon/linux-hisi into soc/dt Merge tag 'socfpga_dts_updates_v6.14' of https://git.kernel.org/pub/scm/linux/kernel/git/dinguyen/linux into soc/dt Merge tag 'imx-bindings-6.14' of https://git.kernel.org/pub/scm/linux/kernel/git/shawnguo/linux into soc/dt Merge tag 'imx-dt-6.14' of https://git.kernel.org/pub/scm/linux/kernel/git/shawnguo/linux into soc/dt Merge tag 'imx-dt64-6.14' of https://git.kernel.org/pub/scm/linux/kernel/git/shawnguo/linux into soc/dt Merge tag 'sti-dt-for-v6.14-round1' of https://git.kernel.org/pub/scm/linux/kernel/git/pchotard/sti into soc/dt Merge tag 'amlogic-arm-dt-for-v6.14' of https://git.kernel.org/pub/scm/linux/kernel/git/amlogic/linux into soc/dt Merge tag 'amlogic-arm64-dt-for-v6.14' of https://git.kernel.org/pub/scm/linux/kernel/git/amlogic/linux into soc/dt Merge tag 'renesas-dts-for-v6.14-tag2' of https://git.kernel.org/pub/scm/linux/kernel/git/geert/renesas-devel into soc/dt Merge tag 'at91-dt-6.14' of https://git.kernel.org/pub/scm/linux/kernel/git/at91/linux into soc/dt Merge tag 'omap-for-v6.14/dt-signed' of https://git.kernel.org/pub/scm/linux/kernel/git/khilman/linux-omap into soc/dt Merge tag 'mtk-dts64-for-v6.14' of https://git.kernel.org/pub/scm/linux/kernel/git/mediatek/linux into soc/dt Merge tag 'mtk-dts32-for-v6.14' of https://git.kernel.org/pub/scm/linux/kernel/git/mediatek/linux into soc/dt Merge tag 'sunxi-dt-for-6.14' of https://git.kernel.org/pub/scm/linux/kernel/git/sunxi/linux into soc/dt Merge tag 'at91-dt-6.14-2' of https://git.kernel.org/pub/scm/linux/kernel/git/at91/linux into soc/dt Merge tag 'arm-soc/for-6.14/devicetree' of https://github.com/Broadcom/stblinux into soc/dt Merge tag 'arm-soc/for-6.14/devicetree-arm64' of https://github.com/Broadcom/stblinux into soc/dt Merge tag 'tegra-for-6.14-arm-dt' of https://git.kernel.org/pub/scm/linux/kernel/git/tegra/linux into soc/dt Merge tag 'tegra-for-6.14-arm64-dt' of https://git.kernel.org/pub/scm/linux/kernel/git/tegra/linux into soc/dt Merge tag 'ti-k3-dt-for-v6.14' of https://git.kernel.org/pub/scm/linux/kernel/git/ti/linux into soc/dt Merge tag 'v6.14-rockchip-dts64-1' of https://git.kernel.org/pub/scm/linux/kernel/git/mmind/linux-rockchip into soc/dt Merge tag 'qcom-arm32-for-6.14' of https://git.kernel.org/pub/scm/linux/kernel/git/qcom/linux into soc/dt Merge tag 'qcom-arm64-for-6.14' of https://git.kernel.org/pub/scm/linux/kernel/git/qcom/linux into soc/dt Merge tag 'mvebu-dt64-6.14-1' of https://git.kernel.org/pub/scm/linux/kernel/git/gclement/mvebu into soc/dt Merge tag 'riscv-dt-for-v6.14' of https://git.kernel.org/pub/scm/linux/kernel/git/conor/linux into soc/dt Merge tag 'amlogic-drivers-for-v6.14' of https://git.kernel.org/pub/scm/linux/kernel/git/amlogic/linux into soc/dt Merge tag 'aspeed-6.14-devicetree' of https://git.kernel.org/pub/scm/linux/kernel/git/joel/bmc into soc/dt Artur Weber (3): ARM: dts: samsung: exynos4212-tab3: Fix headset mic, add jack detection ARM: dts: samsung: exynos4212-tab3: Add MCLK2 clock to WM1811 codec config ARM: dts: samsung: exynos4212-tab3: Drop interrupt from WM1811 codec Barnabás Czémán (2): dt-bindings: arm: qcom: Add Xiaomi Redmi 5A arm64: dts: qcom: Add Xiaomi Redmi 5A Bhavya Kapoor (1): arm64: dts: ti: k3-j722s-evm: Enable support for mcu_i2c0 Biju Das (13): dt-bindings: soc: renesas: Document Renesas RZ/G3E SoC variants dt-bindings: soc: renesas: Document RZ/G3E SMARC SoM and Carrier-II EVK dt-bindings: clock: renesas: Document RZ/G3E SoC CPG arm64: dts: renesas: Add initial DTSI for RZ/G3E SoC arm64: dts: renesas: r9a09g047: Add OPP table arm64: dts: renesas: Add initial support for RZ/G3E SMARC SoM arm64: dts: renesas: Add initial device tree for RZ/G3E SMARC EVK board arm64: dts: renesas: r9a09g047: Add I2C nodes dt-bindings: pinctrl: renesas: Add alpha-numerical port support for RZ/V2H dt-bindings: pinctrl: renesas: Document RZ/G3E SoC arm64: dts: renesas: r9a09g057h44-rzv2h-evk: Replace RZG2L macros arm64: dts: renesas: r9a09g047: Add pincontrol node arm64: dts: renesas: r9a09g047e57-smarc: Add SCIF pincontrol Bjorn Andersson (8): Merge branch '20241027-sar2130p-clocks-v5-0-ecad2a1432ba@linaro.org' into arm64-for-6.13 Merge branch 'icc-sar2130p' of https://git.kernel.org/pub/scm/linux/kernel/git/djakov/icc into HEAD Merge branch '20241028060506.246606-3-quic_srichara@quicinc.com' into arm64-for-6.13 Merge branch 'arm64-for-6.13' into arm64-for-6.14 Merge branch '20241022-qcs615-clock-driver-v4-0-3d716ad0d987@quicinc.com' into HEAD Merge branches '20241204-sm8750_master_clks-v3-0-1a8f31a53a86@quicinc.com' and '20250106-sm8750-dispcc-v2-1-6f42beda6317@linaro.org' into arm64-for-6.14 Merge branch 'icc-sm8750' of https://git.kernel.org/pub/scm/linux/kernel/git/djakov/icc into arm64-for-6.14 Merge branch '20250103-qcom_ipq_cmnpll-v8-1-c89fb4d4849d@quicinc.com' into arm64-for-6.14 Brad Griffis (1): arm64: tegra: Fix Tegra234 PCIe interrupt-map Bryan Brattlof (2): arm64: dts: ti: k3-am62: Remove duplicate GICR reg arm64: dts: ti: k3-am62a: Remove duplicate GICR reg Byoungtae Cho (1): arm64: dts: exynosautov920: add watchdog DT node Chanh Nguyen (4): ARM: dts: aspeed: mtmitchell: Add I2C FAN controllers ARM: dts: aspeed: mtmitchell: Add gpio line names for io expanders dt-bindings: arm: aspeed: add Mt. Jefferson board ARM: dts: aspeed: Add device tree for Ampere's Mt. Jefferson BMC Chen-Yu Tsai (16): arm64: dts: mediatek: mt8183: Disable DPI display output by default arm64: dts: mediatek: mt8183: Disable DSI display output by default arm64: dts: mediatek: mt8173-evb: Drop regulator-compatible property arm64: dts: mediatek: mt8173-elm: Drop regulator-compatible property arm64: dts: mediatek: mt8192-asurada: Drop regulator-compatible property arm64: dts: mediatek: mt8195-cherry: Drop regulator-compatible property arm64: dts: mediatek: mt8195-demo: Drop regulator-compatible property arm64: dts: medaitek: mt8395-nio-12l: Drop regulator-compatible property arm64: dts: mediatek: mt8395-genio-1200-evk: Drop regulator-compatible property arm64: dts: mediatek: mt8173-elm: Fix MT6397 PMIC sub-node names arm64: dts: mediatek: mt8173-evb: Fix MT6397 PMIC sub-node names arm64: dts: mediatek: mt8183-kukui-jacuzzi: Drop pp3300_panel voltage settings Merge branch 'sunxi/shared-clk-ids-for-6.14' into sunxi/dt-for-6.14 arm64: dts: mediatek: mt8192: Drop Chromebook variants that never shipped dt-bindings: arm: mediatek: Drop MT8192 Chromebook variants that never shipped arm64: dts: rockchip: Enable USB 3.0 ports on orangepi-5-plus Chintan Vankar (1): arm64: dts: ti: k3-am62x-sk-common: Add bootph-all property in cpsw_mac_syscon node Christian Bruel (2): arm64: dts: st: Add combophy node on stm32mp251 arm64: dts: st: Enable COMBOPHY on the stm32mp257f-ev1 board Christian Hewitt (1): arm64: dts: meson: remove broadcom wifi compatible from GX reference boards Claudiu Beznea (9): arm64: dts: renesas: r9a08g045: Add the remaining SCIF interfaces arm64: dts: renesas: rzg3s-smarc: Fix the debug serial alias arm64: dts: renesas: r9a08g045: Add ADC node arm64: dts: renesas: rzg3s-smarc-som: Enable ADC arm64: dts: renesas: r9a08g045: Add SSI nodes arm64: dts: renesas: rzg3s-smarc-som: Add versa3 clock generator node arm64: dts: renesas: Add da7212 audio codec node arm64: dts: renesas: rzg3s-smarc: Enable SSI3 arm64: dts: renesas: rzg3s-smarc: Add sound card Cody Eksal (2): dt-bindings: sram: sunxi-sram: Add A100 compatible arm64: dts: allwinner: a100: Add syscon nodes Conor Dooley (1): ARM: dts: socfpga: remove non-existent DAC from CycloneV devkit Cristian Birsan (2): ARM: dts: microchip: sama5d29_curiosity: Add no-1-8-v property to sdmmc0 node ARM: dts: microchip: sama5d27_wlsom1_ek: Add no-1-8-v property to sdmmc0 node Dang Huynh (1): arm64: dts: qcom: Add PM8937 PMIC Dario Binacchi (1): arm64: dts: imx8mn-bsh-smm-s2/pro: add simple-framebuffer Dasnavis Sabiya (1): arm64: dts: ti: k3-am69-sk: Add USB SuperSpeed support Dave Stevenson (3): arm64: dts: broadcom: Add firmware clocks and power nodes to Pi5 DT arm64: dts: broadcom: Add display pipeline support to BCM2712 arm64: dts: broadcom: Add DT for D-step version of BCM2712 David Jander (2): arm64: dts: rockchip: Remove unused i2c2 node from rk3568-mecsbc arm64: dts: rockchip: Add FRAM MB85RS128TY to rk3568-mecsbc Denzeel Oliva (2): dt-bindings: arm: samsung: Add compatible for Samsung Galaxy S20 FE (SM-G780F) arm64: dts: exynos: Add initial support for Samsung Galaxy S20 FE (r8s) Dharma Balasubiramani (1): dt-bindings: atmel-sysreg: add sama7d65 RAM and PIT Dmitry Baryshkov (27): dt-bindings: arm: qcom: add QAR2130P board arm64: dts: qcom: sar2130p: add support for SAR2130P arm64: dts: qcom: sar2130p: add QAR2130P board file arm64: dts: qcom: sm8350-hdk: enable IPA arm64: dts: qcom: sm8550: correct MDSS interconnects arm64: dts: qcom: sm8650: correct MDSS interconnects arm64: dts: qcom: msm8916: correct sleep clock frequency arm64: dts: qcom: msm8939: correct sleep clock frequency arm64: dts: qcom: msm8994: correct sleep clock frequency arm64: dts: qcom: qcs404: correct sleep clock frequency arm64: dts: qcom: q[dr]u1000: correct sleep clock frequency arm64: dts: qcom: qrb4210-rb2: correct sleep clock frequency arm64: dts: qcom: sar2130p: correct sleep clock frequency arm64: dts: qcom: sc7280: correct sleep clock frequency arm64: dts: qcom: sdx75: correct sleep clock frequency arm64: dts: qcom: sm4450: correct sleep clock frequency arm64: dts: qcom: sm6125: correct sleep clock frequency arm64: dts: qcom: sm6375: correct sleep clock frequency arm64: dts: qcom: sm8250: correct sleep clock frequency arm64: dts: qcom: sm8350: correct sleep clock frequency arm64: dts: qcom: sm8450: correct sleep clock frequency arm64: dts: qcom: sm8550: correct sleep clock frequency arm64: dts: qcom: sm8650: correct sleep clock frequency arm64: dts: qcom: x1e80100: correct sleep clock frequency arm64: dts: qcom: sc8180x: drop extra XO clock frequencies arm64: dts: qcom: sdm670: move board clocks to sdm670.dtsi file arm64: dts: qcom: q[dr]u1000: move board clocks to qdu1000.dtsi file Dragan Simic (1): arm64: dts: rockchip: Delete redundant RK3328 GMAC stability fixes E Shattow (2): riscv: dts: starfive: jh7110-pine64-star64: enable usb0 host function riscv: dts: starfive: jh7110-milkv-mars: enable usb0 host function Eddie James (4): ARM: dts: aspeed: Fix Rainier and Blueridge GPIO LED names arm: dts: aspeed: Everest and Fuji: Add VRM presence gpio expander ARM: dts: aspeed: Blueridge and Fuji: Fix LED node names arm: dts: aspeed: Blueridge and Rainer: Add VRM presence GPIOs FUKAUMI Naoki (2): dt-bindings: arm: rockchip: Add Radxa E52C arm64: dts: rockchip: Add Radxa E52C Fabio Estevam (3): ARM: dts: imx6qdl-apalis: Change to "adi,force-bt656-4" arm64: dts: imx8mm-phg: Add LVDS compatible string ARM: dts: imx: Use the correct mdio pattern Fabrice Gasnier (5): ARM: dts: stm32: populate all timer counter nodes on stm32mp13 ARM: dts: stm32: populate all timer counter nodes on stm32mp15 ARM: dts: stm32: add counter subnodes on stm32mp135f-dk ARM: dts: stm32: add counter subnodes on stm32mp157c-ev1 ARM: dts: stm32: add counter subnodes on stm32mp157 dk boards Faraz Ata (1): arm64: dts: exynosautov920: Add DMA nodes Fei Shao (2): dt-bindings: arm: mediatek: Add MT8188 Lenovo Chromebook Duet (11", 9) arm64: dts: mediatek: Introduce MT8188 Geralt platform based Ciri Francesco Valla (1): arm64: dts: ti: k3-am625-beagleplay: Fix DP83TD510E reset time Frank Li (2): arm64: dts: imx8mq-zii-ultra: remove #address-cells of eeprom@a4 arm64: dts: imx93-9x9-qsb: add temp-sensor nxp,p3t1085 Frank Wang (1): arm64: dts: rockchip: add usb related nodes for rk3576 Frank Wunderlich (29): arm64: dts: mt7986: add overlay for SATA power socket on BPI-R3 arm64: dts: mediatek: mt7988: Add pinctrl support arm64: dts: mediatek: mt7988a-bpi-r4: Add pinctrl subnodes for bpi-r4 arm64: dts: mediatek: mt7988: Add reserved memory arm64: dts: mediatek: mt7988: Add mmc support arm64: dts: mediatek: mt7988: Add lvts node arm64: dts: mediatek: mt7988: Add thermal-zone arm64: dts: mediatek: mt7988: Add missing clock-div property for i2c arm64: dts: mediatek: mt7988: Add mcu-sys node for cpu arm64: dts: mediatek: mt7988: Add CPU OPP table for clock scaling arm64: dts: mediatek: mt7988: Disable usb controllers by default arm64: dts: mediatek: mt7988: Add t-phy for ssusb1 arm64: dts: mediatek: mt7988: Add pcie nodes arm64: dts: mediatek: mt7988a-bpi-r4: Enable watchdog arm64: dts: mediatek: mt7988a-bpi-r4: Add fixed regulators for 1v8 and 3v3 arm64: dts: mediatek: mt7988a-bpi-r4: Add dt overlays for sd + emmc arm64: dts: mediatek: mt7988a-bpi-r4: Add thermal configuration arm64: dts: mediatek: mt7988a-bpi-r4: Enable serial0 debug uart arm64: dts: mediatek: mt7988a-bpi-r4: Add default UART stdout arm64: dts: mediatek: mt7988a-bpi-r4: Enable I2C controllers arm64: dts: mediatek: mt7988a-bpi-r4: Add PCA9545 I2C Mux arm64: dts: mediatek: mt7988a-bpi-r4: Enable t-phy for ssusb1 arm64: dts: mediatek: mt7988a-bpi-r4: Enable ssusb1 on bpi-r4 arm64: dts: mediatek: mt7988a-bpi-r4: Enable pwm arm64: dts: mediatek: mt7988a-bpi-r4: Enable pcie arm64: dts: mediatek: mt7988a-bpi-r4: Add MediaTek MT6682A/RT5190A PMIC arm64: dts: mediatek: mt7988a-bpi-r4: Add proc-supply for cpus arm64: dts: marvell: only enable complete sata nodes arm64: dts: marvell: drop additional phy-names for sata Gabor Juhos (1): dt-bindings: arm: qcom: add missing elements to the SoC list Geert Uytterhoeven (15): ARM: dts: marvell: mmp2-olpc-xo-1-75: Switch to {hp,mic}-det-gpios arm64: dts: uniphier: Switch to hp-det-gpios ARM: dts: imx: Switch to {hp,mic}-det-gpios arm64: dts: imx: Switch to simple-audio-card,hp-det-gpios dt-bindings: soc: renesas: Move R8A779G0 White Hawk up dt-bindings: soc: renesas: Document R8A779G3 White Hawk Single arm64: dts: renesas: Factor out White Hawk Single board support arm64: dts: renesas: Add R8A779G3 SoC support arm64: dts: renesas: r8a779g3: Add White Hawk Single support arm64: dts: renesas: white-hawk-ard-audio: Drop SoC part arm64: dts: renesas: white-hawk-single: Add R-Car Sound support ARM: dts: renesas: r7s72100: Add DMA support to RSPI Merge tag 'renesas-r9a09g047-dt-binding-defs-tag1' into renesas-dts-for-v6.14 Merge tag 'renesas-r9a09g057-dt-binding-defs-tag2' into renesas-dts-for-v6.14 Merge tag 'renesas-r9a09g047-dt-binding-defs-tag2' into renesas-dts-for-v6.14 Heiko Schocher (2): dt-bindings: arm: fsl: Add ABB SoM and carrier arm64: dts: imx8mp: add aristainetos3 board support Heiko Stuebner (2): arm64: dts: rockchip: hook up the MCU on the QNAP TS433 arm64: dts: rockchip: set hdd led labels on QNAP-TS433 Hsiao Chien Sung (1): dt-bindings: display: mediatek: ovl: Modify rules for MT8195/MT8188 Hsin-Te Yuan (3): arm64: dts: mediatek: mt8183: kenzo: Support second source touchscreen arm64: dts: mediatek: mt8183: willow: Support second source touchscreen arm64: dts: mediatek: mt8188: Add GPU speed bin NVMEM cells Hsin-Yi Wang (1): arm64: dts: mt8183: set DMIC one-wire mode on Damu Hui Wang (1): ARM: dts: imx6qdl-sabresd: add dr_mode to usbotg Igor Belwon (3): arm64: dts: exynos990: Add pmu and syscon-reboot nodes dt-bindings: clock: samsung: Add Exynos990 SoC CMU bindings arm64: dts: exynos990: Add clock management unit nodes Imran Shaik (1): arm64: dts: qcom: qcs8300: Add support for clock controllers Ivan Sergeev (2): dt-bindings: arm: rockchip: Add BigTreeTech CB2 and Pi2 arm64: dts: rockchip: Add BigTreeTech CB2 and Pi2 Ivaylo Ivanov (3): arm64: dts: exynos8895: Add serial_0/1 nodes arm64: dts: exynos8895: Add a PMU node for the second cluster arm64: dts: exynos8895: Add camera hsi2c nodes Jacopo Mondi (2): arm64: dts: renesas: r8a779g0: Add FCPVX instances arm64: dts: renesas: r8a779g0: Add VSPX instances Jagan Teki (1): arm64: dts: rockchip: Fix PCIe3 handling for Edgeble-6TOPS Modules Jakob Unterwurzacher (1): arm64: dts: rockchip: increase gmac rx_delay on rk3399-puma Jason-JH.Lin (3): dt-bindings: display: mediatek: ovl: Add compatible strings for MT8188 MDP3 dts: arm64: mediatek: mt8188: Update OVL compatible from MT8183 to MT8195 dts: arm64: mediatek: mt8195: Remove MT8183 compatible for OVL Jens Glathe (4): dt-bindings: arm: qcom: Add HP Omnibook X 14 arm64: dts: qcom: x1e80100-hp-x14: dt for HP Omnibook X Laptop 14 dt-bindings: arm: qcom: Add Microsoft Windows Dev Kit 2023 arm64: dts: qcom: sc8280xp-blackrock: dt definition for WDK2023 Jianhua Lu (3): arm64: dts: qcom: sm8250-xiaomi-elish: Add qca6390-pmu node arm64: dts: qcom: sm8250-xiaomi-elish: Add wifi node arm64: dts: qcom: sm8250-xiaomi-elish: Add bluetooth node Jie Gan (3): arm64: dts: qcom: qcs615: Add coresight nodes arm64: dts: qcom: qcs8300: Add coresight nodes arm64: dts: qcom: x1e80100: Add coresight nodes Jimmy Hon (3): arm64: dts: rockchip: refactor common rk3588-orangepi-5.dtsi dt-bindings: arm: rockchip: Add Xunlong Orange Pi 5 Max arm64: dts: rockchip: Add Orange Pi 5 Max board Jingyi Wang (6): dt-bindings: arm: qcom: document QCS8300 SoC and reference board arm64: dts: qcom: add QCS8300 platform arm64: dts: qcom: qcs8300: add base QCS8300 RIDE board arm64: dts: qcom: qcs8300: Add PMU support for QCS8300 arm64: dts: qcom: qcs8300: Add LLCC support for QCS8300 arm64: dts: qcom: qcs8300: Add capacity and DPC properties Joel Stanley (1): arm64: dts: qcom: x1e80100-romulus: Update firmware nodes Jonas Karlman (1): arm64: dts: rockchip: Fix sdmmc access on rk3308-rock-s0 v1.1 boards Josua Mayer (2): arm64: dts: marvell: cn9131-cf-solidwan: fix cp1 comphy links arm64: dts: ti: k3-am642-hummingboard-t: Convert overlay to board dts Joy Zou (1): arm64: dts: imx93: add pca9452 support Judith Mendez (1): ARM: dts: ti: am437x-l4: remove autoidle for UART Kever Yang (4): arm64: dts: rockchip: Add rk3576 naneng combphy nodes dt-bindings: arm: rockchip: Sort for boards not in correct order dt-bindings: arm: rockchip: Add rk3576 evb1 board arm64: dts: rockchip: Add rk3576 evb1 board Konrad Dybcio (12): arm64: dts: qcom: x1e80100-romulus: Configure audio arm64: dts: qcom: x1e80100-romulus: Set up PCIe3 / SDCard reader arm64: dts: qcom: x1e80100-romulus: Set up PS8830s dt-bindings: arm: qcom-soc: Extend X1E prefix match for X1P dt-bindings: arm: qcom: Add X1P42100 SoC & CRD arm64: dts: qcom: pmk8350: Add more SDAM slices arm64: dts: qcom: qcs6490-rb3gen2: Configure onboard LEDs arm64: dts: qcom: sa8775p: Use a SoC-specific compatible for GPI DMA arm64: dts: qcom: sa8775p: Use valid node names for GPI DMAs arm64: dts: qcom: msm8996: Fix up USB3 interrupts arm64: dts: qcom: msm8994: Describe USB interrupts arm64: dts: qcom: sc8280xp: Fix up remoteproc register space sizes Krishna Kurapati (14): arm64: dts: qcom: qcs615: Add primary USB interface arm64: dts: qcom: qcs615-ride: Enable primary USB interface arm64: dts: qcom: qcs615: Add support for secondary USB node on QCS615 arm64: dts: qcom: qcs615-ride: Enable secondary USB controller on QCS615 Ride arm64: dts: qcom: sm8350: Disable USB U1/U2 entry arm64: dts: qcom: sm8450: Disable USB U1/U2 entry arm64: dts: qcom: sm8150: Disable USB U1/U2 entry arm64: dts: qcom: sm6125: Disable USB U1/U2 entry arm64: dts: qcom: sm8250: Disable USB U1/U2 entry arm64: dts: qcom: sm6350: Disable USB U1/U2 entry arm64: dts: qcom: sc7280: Disable USB U1/U2 entry arm64: dts: qcom: sa8775p: Disable USB U1/U2 entry arm64: dts: qcom: qcs8300: Add support for usb nodes arm64: dts: qcom: qcs8300-ride: Enable USB controllers Krishna chaitanya chundru (2): ARM: dts: qcom: sdx65: Add PCIe EP interconnect path ARM: dts: qcom: sdx55: Add CPU PCIe EP interconnect path Krzysztof Kozlowski (27): arm64: dts: mediatek: mt8183-kukui: align thermal node names with bindings arm64: dts: qcom: sm8650: Fix CDSP context banks unit addresses Merge branch 'for-v6.14/dt-bindings-clk-samsung' into next/dt64 dt-bindings: clock: qcom,sm8550-dispcc: Add SM8750 DISPCC arm64: dts: qcom: sm8350: Fix ADSP memory base and length arm64: dts: qcom: sm8350: Fix CDSP memory base and length arm64: dts: qcom: sm8350: Fix MPSS memory length arm64: dts: qcom: sm8450: Fix ADSP memory base and length arm64: dts: qcom: sm8450: Fix CDSP memory length arm64: dts: qcom: sm8450: Fix MPSS memory length arm64: dts: qcom: sm8550: Fix ADSP memory base and length arm64: dts: qcom: sm8550: Fix CDSP memory length arm64: dts: qcom: sm8550: Fix MPSS memory length arm64: dts: qcom: sm8650: Fix ADSP memory base and length arm64: dts: qcom: sm8650: Fix CDSP memory length arm64: dts: qcom: sm8650: Fix MPSS memory length arm64: dts: qcom: x1e80100: Fix ADSP memory base and length arm64: dts: qcom: x1e80100: Fix CDSP memory length arm64: dts: qcom: sm6350: Fix ADSP memory length arm64: dts: qcom: sm6350: Fix MPSS memory length arm64: dts: qcom: sm6375: Fix ADSP memory length arm64: dts: qcom: sm6375: Fix CDSP memory base and length arm64: dts: qcom: sm6375: Fix MPSS memory base and length arm64: dts: qcom: sdx75: Fix MPSS memory length arm64: dts: qcom: sm6115: Fix MPSS memory length arm64: dts: qcom: sm6115: Fix CDSP memory length arm64: dts: qcom: sm6115: Fix ADSP memory base and length Kuninori Morimoto (1): arm64: dts: renesas: ulcb: Add sample Audio Codec settings Kyle Deng (1): arm64: dts: qcom: qcs615: add AOSS_QMP node Leonard Göhrs (6): ARM: dts: stm32: lxa-tac: disable the real time clock ARM: dts: stm32: lxa-tac: extend the alias table ARM: dts: stm32: lxa-tac: adjust USB gadget fifo sizes for multi function dt-bindings: arm: stm32: add compatible strings for Linux Automation LXA TAC gen 3 ARM: dts: stm32: lxa-tac: move adc and gpio{e,g} to gen{1,2} boards ARM: dts: stm32: lxa-tac: Add support for generation 3 devices Lijuan Gao (7): dt-bindings: arm: qcom: document QCS615 and the reference board arm64: dts: qcom: add QCS615 platform arm64: dts: qcom: qcs615: add base RIDE board arm64: dts: qcom: qcs615: Add CPU and LLCC BWMON support arm64: dts: qcom: correct gpio-ranges for QCS615 arm64: dts: qcom: correct gpio-ranges for QCS8300 arm64: dts: qcom: qcs615: Add CPU capacity and DPC properties Ling Xu (1): arm64: dts: qcom: qcs8300: Add ADSP and CDSP0 fastrpc nodes Linus Walleij (9): ARM: dts: bcm6846: Add iproc rng ARM: dts: bcm6846: Enable watchdog ARM: dts: bcm6846: Add GPIO blocks ARM: dts: bcm6846: Add MDIO control block ARM: dts: bcm6846: Add LED controller ARM: dts: bcm6846: Add ARM PL081 DMA block dt-bindings: vendor-prefixes: Add Genexis dt-bindings: arm: bcmbca: Add Genexis XG6846B ARM: dts: broadcom: Add Genexis XG6846B DTS file Liu Ying (2): arm64: dts: imx8mp-skov-revb-mi1010ait-1cp1: Set "media_disp2_pix" clock rate to 70MHz arm64: dts: imx8mp-evk: Add NXP LVDS to HDMI adapter cards Luca Weiss (4): arm64: dts: qcom: sm6350: Fix uart1 interconnect path arm64: dts: qcom: sm7225-fairphone-fp4: Drop extra qcom,msm-id value arm64: dts: qcom: qcm6490-fairphone-fp5: Prefix regulator-fixed label arm64: dts: qcom: qcm6490-fairphone-fp5: Enable camera EEPROMs Luo Jie (3): dt-bindings: clock: qcom: Add CMN PLL clock controller for IPQ SoC arm64: dts: qcom: ipq9574: Add CMN PLL node arm64: dts: qcom: ipq9574: Update xo_board_clk to use fixed factor clock MD Danish Anwar (2): dt-bindings: soc: ti: pruss: Add clocks for ICSSG arm64: dts: ti: k3-am64-main: Switch ICSSG clock to core clock Mahadevan (1): arm64: dts: qcom: sa8775p: add display dt nodes for MDSS0 and DPU Mamta Shukla (1): arm: dts: socfpga: use reset-name "stmmaceth-ocp" instead of "ahb" Manikanta Mylavarapu (6): arm64: dts: qcom: ipq5424: Add smem and tcsr_mutex nodes arm64: dts: qcom: ipq5424: Add watchdog node arm64: dts: qcom: ipq5424: add spi nodes arm64: dts: qcom: ipq5424: configure spi0 node for rdp466 arm64: dts: qcom: ipq5424: add scm node arm64: dts: qcom: ipq5424: enable the download mode support Manivannan Sadhasivam (1): arm64: dts: qcom: sa8775p: Fix the size of 'addr_space' regions Manojkiran Eda (1): ARM: dts: aspeed: Enable PECI and LPC snoop for IBM System1 Mao Jinlong (1): arm64: dts: qcom: sm8450: Add coresight nodes Marek Vasut (6): MAINTAINERS: Update entry for DH electronics DHSOM SoMs and boards ARM: dts: stm32: Deduplicate serial aliases and chosen node for STM32MP15xx DHCOM SoM ARM: dts: stm32: Increase CPU core voltage on STM32MP13xx DHCOR SoM ARM: dts: stm32: Sort M24256E write-lockable page in DH STM32MP13xx DHCOR SoM DT ARM: dts: stm32: Swap USART3 and UART8 alias on STM32MP15xx DHCOM SoM arm64: dts: qcom: msm8996-xiaomi-gemini: Fix LP5562 LED1 reg property Markus Niebel (2): arm64: dts: imx93-tqma9352-mba93xxca: enable Open Drain for MDIO arm64: dts: imx93-tqma9352-mba93xxla: enable Open Drain for MDIO Markuss Broks (2): arm64: dts: exynos: Add Exynos9810 SoC support arm64: dts: exynos: Add initial support for Samsung Galaxy S9 (SM-G960F) Martin Blumenstingl (1): ARM: dts: amlogic: meson: remove size and address cells from USB nodes Maud Spierings (3): arm64: dts: qcom: x1e80100-vivobook-s15: Enable the gpu arm64: dts: qcom: x1e80100-vivobook-s15: Use the samsung,atna33xc20 panel driver arm64: dts: qcom: x1e80100-vivobook-s15: Add lid switch Maulik Shah (1): arm64: dts: qcom: sa8775p: Add CPUs to psci power domain Md Sadre Alam (3): arm64: dts: qcom: ipq5424: add TRNG node arm64: dts: qcom: ipq9574: update TRNG compatible arm64: dts: qcom: ipq5332: update TRNG compatible Melody Olvera (6): dt-bindings: arm: qcom: Document SM8750 SoC and boards arm64: dts: qcom: Add PMD8028 PMIC arm64: dts: qcom: Add PMIH0108 PMIC arm64: dts: qcom: Add base SM8750 dtsi arm64: dts: qcom: sm8750: Add pmic dtsi arm64: dts: qcom: sm8750: Add MTP and QRD boards Mesih Kilinc (3): ARM: dts: suniv: f1c100s: Add support for DMA ARM: dts: suniv: f1c100s: Add support for Audio Codec ARM: dts: suniv: f1c100s: Activate Audio Codec for Lichee Pi Nano Michael Riesch (2): arm64: dts: rockchip: fix num-channels property of wolfvision pf5 mic arm64: dts: rockchip: enable hdmi out audio on wolfvision pf5 Michal Pecio (1): ARM: tegra: nyan: Maintain power to USB ports on boot Michal Wilczynski (1): riscv: dts: thead: Add mailbox node Mihai Sain (4): ARM: dts: microchip: sam9x7: Move i2c address/size to dtsi ARM: dts: microchip: sam9x75_curiosity: Add power monitor support ARM: dts: microchip: sam9x60: Add address/size to spi-controller nodes ARM: dts: microchip: sam9x7: Add address/size to spi-controller nodes Naresh Solanki (1): dt-bindings: arm: aspeed: add IBM SBP1 board Neil Armstrong (13): dt-bindings: soc: amlogic,meson-gx-hhi-sysctrl: Document the System Control registers found on early Meson SoC arm64: dts: qcom: sm8550: add interconnect and opp-peak-kBps for GPU arm64: dts: qcom: sm8650: add interconnect and opp-peak-kBps for GPU arm64: dts: qcom: qcm6490-shift-otter: remove invalid orientation-switch arm64: dts: qcom: sdm845-db845c-navigation-mezzanine: remove disabled ov7251 camera arm64: dts: qcom: sc7180-trogdor-quackingstick: add missing avee-supply arm64: dts: qcom: sc7180-trogdor-pompom: rename 5v-choke thermal zone arm64: dts: qcom: sc7180: fix psci power domain node names arm64: dts: qcom: sm8150-microsoft-surface-duo: fix typos in da7280 properties arm64: dts: qcom: pmi8950: add LAB-IBB nodes arm64: dts: qcom: sdm450-lenovo-tbx605f: add DSI panel nodes arm64: dts: qcom: sm8550: Add 'global' interrupt to the PCIe RC nodes arm64: dts: qcom: sm8650: Add 'global' interrupt to the PCIe RC nodes Niklas Cassel (1): arm64: dts: rockchip: enable the mmu600_pcie IOMMU on the rk3588 SoC Niklas Söderlund (4): arm64: dts: renesas: gray-hawk-single: Add video capture support arm64: dts: renesas: r8a779a0: Remove address- and size-cells from AVB[1-5] arm64: dts: renesas: falcon-ethernet: Describe PHYs connected on the breakout board arm64: dts: renesas: white-hawk-csi-dsi: Define CSI-2 data line orders Ninad Palsule (4): ARM: dts: aspeed: system1: Bump up i2c busses freq ARM: dts: aspeed: system1: Enable serial gpio0 ARM: dts: aspeed: system1: Add GPIO line names ARM: dts: aspeed: system1: Use crps PSU driver Niravkumar L Rabara (2): arm64: dts: socfpga: agilex: Add VGIC maintenance interrupt arm64: dts: socfpga: agilex5: Add gpio0 node and spi dma handshake id Nícolas F. R. A. Prado (5): arm64: dts: mediatek: mt8186: Move wakeup to MTU3 to get working suspend arm64: dts: mt6359: Add #sound-dai-cells property arm64: dts: mediatek: mt8390-genio-700-evk: Add sound output support arm64: dts: mediatek: mt8195: Remove suspend-breaking reset from pcie1 arm64: dts: mediatek: Set mediatek,mac-wol on DWMAC node for all boards Olivier Moysan (3): arm64: dts: st: add i2s support to stm32mp251 arm64: dts: st: add sai support on stm32mp251 arm64: dts: st: add spdifrx support on stm32mp251 Otto Pflüger (1): arm64: dts: qcom: Add initial support for MSM8917 Patrick Rudolph (1): ARM: dts: aspeed: sbp1: IBM sbp1 BMC board Patrick Williams (1): ARM: dts: aspeed: yosemite4: adjust secondary flash name Peng Fan (3): arm64: dts: freescale: imx93-11x11-evk: enable fsl,ext-reset-output for wdog3 arm64: dts: freescale: imx93-14x14-evk: enable fsl,ext-reset-output for wdog3 arm64: dts: freescale: imx93-9x9-qsb: enable fsl,ext-reset-output for wdog3 Pengyu Luo (2): dt-bindings: arm: qcom: Document Huawei Matebook E Go (sc8280xp) arm64: dts: qcom: sc8280xp: Add Huawei Matebook E Go (sc8280xp) Peter Yin (2): ARM: dts: aspeed: Harma: add rtc device ARM: dts: aspeed: Harma: revise sgpio line name Petr Vorel (1): arm64: dts: qcom: msm8994-angler: Enable power key, volume up/down Potin Lai (6): ARM: dts: aspeed: catalina: add i2c-mux-idle-disconnect to all mux ARM: dts: aspeed: catalina: move hdd board i2c mux bus to i2c5 ARM: dts: aspeed: catalina: enable mac2 ARM: dts: aspeed: catalina: update NIC1 fru address ARM: dts: aspeed: catalina: revise ltc4287 shunt-resistor value ARM: dts: aspeed: catalina: remove interrupt of GPIOB4 form all IOEXP Prashanth K (11): arm64: dts: qcom: sdm630: Disable USB U1/U2 entry arm64: dts: qcom: sdm845: Disable USB U1/U2 entry arm64: dts: qcom: sdx75: Disable USB U1/U2 entry arm64: dts: qcom: qcs404: Disable USB U1/U2 entry arm64: dts: qcom: sc7180: Disable USB U1/U2 entry arm64: dts: qcom: x1e80100: Disable USB U1/U2 entry arm64: dts: qcom: qdu1000: Disable USB U1/U2 entry arm64: dts: qcom: sc8280xp: Disable USB U1/U2 entry arm64: dts: qcom: sc8180x: Disable USB U1/U2 entry ARM: dts: qcom: sdx65: Disable USB U1/U2 entry ARM: dts: qcom: sdx55: Disable USB U1/U2 entry Qiang Yu (1): arm64: dts: qcom: x1e80100: Add support for PCIe3 on x1e80100 Qingqing Zhou (2): arm64: dts: qcom: qcs615: add the SCM node arm64: dts: qcom: qcs615: add the APPS SMMU node Rafał Miłecki (1): ARM: dts: mediatek: mt7623: fix IR nodename Rakesh Kota (1): arm64: dts: qcom: qcm6490-idp: Allow UFS regulators load/mode setting Raviteja Laggyshetty (1): dt-bindings: interconnect: add interconnect bindings for SM8750 Richard Acayan (5): arm64: dts: qcom: pm660l: add flash leds arm64: dts: qcom: sdm670-google-sargo: add flash leds arm64: dts: qcom: sdm670: add gpu arm64: dts: qcom: sdm670-google-sargo: enable gpu arm64: dts: qcom: sdm670: add camcc Ricky CX Wu (23): ARM: dts: aspeed: yosemite4: Remove temperature sensors on Medusa Board ARM: dts: aspeed: yosemite4: Change eeprom for Medusa Board ARM: dts: aspeed: yosemite4: Enable watchdog2 ARM: dts: aspeed: yosemite4: Enable adc15 ARM: dts: aspeed: yosemite4: Enable interrupt setting for pca9555 ARM: dts: aspeed: yosemite4: Revise to use adm1281 on Medusa board ARM: dts: aspeed: yosemite4: Add gpio pca9506 for CPLD IOE ARM: dts: aspeed: yosemite4: Revise adc128d818 adc mode on Spider Board ARM: dts: aspeed: yosemite4: Enable spi-gpio setting for TPM ARM: dts: aspeed: yosemite4: Revise quad mode to dual mode ARM: dts: aspeed: yosemite4: revise flash layout to 128MB ARM: dts: aspeed: yosemite4: Add i2c-mux for Management Board ARM: dts: aspeed: yosemite4: correct the compatible string of adm1272 ARM: dts: aspeed: yosemite4: Remove IO expanders on I2C bus 13 ARM: dts: aspeed: yosemite4: add i2c-mux for all Server Board slots ARM: dts: aspeed: yosemite4: Add i2c-mux for four NICs ARM: dts: aspeed: yosemite4: Add i2c-mux for CPLD IOE on Spider Board ARM: dts: aspeed: yosemite4: Add required properties for IOE on fan boards ARM: dts: aspeed: yosemite4: correct the compatible string for max31790 ARM: dts: aspeed: yosemite4: Revise address of i2c-mux for two fan boards ARM: dts: aspeed: yosemite4: Change the address of Fan IC on fan boards ARM: dts: aspeed: yosemite4: Revise adc128d818 adc mode on Fan Boards ARM: dts: aspeed: yosemite4: Add i2c-mux for ADC monitor on Spider Board Rob Herring (Arm) (8): ARM: dts: aspeed: Fix at24 EEPROM node names ARM: dts: nuvoton: Fix at24 EEPROM node names arm64: dts: altera: Remove unused and undocumented "snps,max-mtu" property arm64: dts: hisilicon: Remove unused and undocumented "enable-dma" and "bus-id" properties arm: dts: broadcom: Remove unused and undocumented properties arm64: dts: broadcom: Remove unused and undocumented properties arm64: dts: ti: Remove unused and undocumented "ti,(rx|tx)-fifo-depth" properties arm64: dts: qcom: Remove unused and undocumented properties Romain Naour (1): ARM: dts: dra7: Add bus_dma_limit for l4 cfg bus Romain Sioen (2): dt-bindings: ARM: at91: Document Microchip SAMA7D65 Curiosity ARM: dts: microchip: add support for sama7d65_curiosity board Rosen Penev (2): ARM: dts: meraki-mr26: set mac address for gmac0 arm64: dts: bcm4908: nvmem-layout conversion Ryan Wanner (2): ARM: dts: at91: Add sama7d65 pinmux ARM: dts: microchip: add sama7d65 SoC DT Sam Edwards (4): arm64: dts: broadcom: bcmbca: bcm4908: Reserve CFE stub area arm64: dts: broadcom: bcmbca: bcm4908: Protect cpu-release-addr dt-bindings: arm64: bcmbca: Add Zyxel EX3510-B based on BCM4906 arm64: dts: broadcom: bcmbca: bcm4908: Add DT for Zyxel EX3510-B Sam Protsenko (1): arm64: dts: exynos850-e850-96: Specify reserved secure memory explicitly Sayali Lokhande (2): arm64: dts: qcom: qcs615: add UFS node arm64: dts: qcom: qcs615-ride: Enable UFS node Sebastian Reichel (1): arm64: dts: rockchip: add WLAN to rk3588-evb1 controller Shimrra Shai (2): dt-bindings: arm: rockchip: Add Firefly ITX-3588J board arm64: dts: rockchip: add DTs for Firefly ITX-3588J and its Core-3588J SoM Sibi Sankar (5): dt-bindings: arm: qcom: Add Snapdragon Devkit for Windows arm64: dts: qcom: Add X1E001DE Snapdragon Devkit for Windows arm64: dts: qcom: x1e001de-devkit: Add audio related nodes arm64: dts: qcom: x1e001de-devkit: Enable external DP support arm64: dts: qcom: x1e001de-devkit: Enable SD card support Siddharth Vadapalli (7): arm64: dts: ti: k3-pinctrl: Introduce deep sleep macros arm64: dts: ti: k3-am62x-sk-common: Support SoC wakeup using USB1 wakeup arm64: dts: ti: k3-am62p-j722s-common-main: Enable USB0 for DFU boot arm64: dts: ti: Makefile: Fix typo "k3-j7200-evm-pcie1-ep.dtbo" arm64: dts: ti: k3-j721e-evm: Add overlay for PCIE1 Endpoint Mode arm64: dts: ti: k3-am68-sk-base-board: Add overlay for PCIE1 Endpoint Mode arm64: dts: ti: k3-am69-sk: Add overlay for PCIE0 Endpoint Mode Sjoerd Simons (1): arm64: dts: mediatek: mt8365-evk: Set ethernet alias Song Xue (1): arm64: dts: qcom: qcs615: Add LLCC support for QCS615 Soutrik Mukhopadhyay (2): arm64: dts: qcom: sa8775p: add DisplayPort device nodes arm64: dts: qcom: sa8775p-ride: Enable Display Port Sricharan Ramabadhran (2): dt-bindings: qcom: Add ipq5424 boards arm64: dts: qcom: add IPQ5424 SoC and rdp466 board support Srinivas Kandagatla (1): arm64: dts: qcom: x1e78100-t14s: add sound support Stanislav Jakubek (6): arm64: dts: sprd: sp9860g-1h10: fix constant-charge-voltage-max-microvolt property arm64: dts: sprd: sp9860g-1h10: fix factory-internal-resistance-micro-ohms property arm64: dts: sprd: sc2731: move fuel-gauge monitored-battery to device DTS arm64: dts: sprd: sc9863a: fix in-ports property arm64: dts: sprd: sc9863a: reorder clocks, clock-names per bindings arm64: dts: sprd: Fix battery-detect-gpios property Stefan Kerkmann (3): ARM: dts: imx6qdl: add phy-3p0-supply to usb phys ARM: dts: imx6sl: add phy-3p0-supply to usb phys ARM: dts: imx6sx: add phy-3p0-supply to usb phys Stephan Gerhold (14): arm64: dts: qcom: x1e80100-pmics: Enable all SMB2360 separately arm64: dts: qcom: x1e80100: Add QUP power domains and OPPs arm64: dts: qcom: x1e80100: Add uart14 arm64: dts: qcom: x1e001de-devkit: Fix USB QMP PHY supplies arm64: dts: qcom: x1e78100-lenovo-thinkpad-t14s: Fix USB QMP PHY supplies arm64: dts: qcom: x1e80100-asus-vivobook-s15: Fix USB QMP PHY supplies arm64: dts: qcom: x1e80100-crd: Fix USB QMP PHY supplies arm64: dts: qcom: x1e80100-dell-xps13-9345: Fix USB QMP PHY supplies arm64: dts: qcom: x1e80100-lenovo-yoga-slim7x: Fix USB QMP PHY supplies arm64: dts: qcom: x1e80100-microsoft-romulus: Fix USB QMP PHY supplies arm64: dts: qcom: x1e80100-qcp: Fix USB QMP PHY supplies arm64: dts: qcom: x1e80100-qcp: Add FSUSB42 USB switches arm64: dts: qcom: x1e80100-qcp: Enable external DP support arm64: dts: qcom: msm8916-samsung-serranove: Add display panel Sumit Gupta (2): arm64: tegra: Fix typo in Tegra234 dce-fabric compatible arm64: tegra: Disable Tegra234 sce-fabric node Taniya Das (5): dt-bindings: clock: qcom: Add QCS615 GCC clocks arm64: dts: qcom: sa8775p: Update sleep_clk frequency arm64: dts: qcom: sa8775p: Add support for clock controllers dt-bindings: clock: qcom: Add SM8750 GCC dt-bindings: clock: qcom: Document the SM8750 TCSR Clock Controller Thomas Richard (1): arm64: dts: ti: k3-j784s4: Use ti,j7200-padconf compatible Tingguo Cheng (3): arm64: dts: qcom: qcs615: Adds SPMI support arm64: dts: qcom: move pon reboot-modes from pm8150.dtsi to board files arm64: dts: qcom: qcs615-ride: Enable PMIC peripherals Tomi Valkeinen (3): arm64: dts: renesas: gray-hawk-single: Fix indentation arm64: dts: renesas: r8a779h0: Add display support arm64: dts: renesas: gray-hawk-single: Add DisplayPort support Udit Kumar (1): arm64: dts: ti: k3-j722s-evm: Enable PMIC Umer Uddin (5): dt-bindings: arm: samsung: samsung-boards: Add bindings for SM-G981B and SM-G980F board arm64: dts: exynos: Add initial support for Samsung Galaxy S20 Series boards (x1s-common) arm64: dts: exynos: Add initial support for Samsung Galaxy S20 5G (x1s) arm64: dts: exynos: Add initial support for Samsung Galaxy S20 (x1slte) arm64: dts: exynos990: Add a PMU node for the third cluster Uwe Kleine-König (1): ARM: dts: socfpga_cyclone5_mcvevk: Drop unused #address-cells/#size-cells Val Packett (7): arm64: dts: mediatek: mt8516: fix GICv2 range arm64: dts: mediatek: mt8516: fix wdt irq type arm64: dts: mediatek: mt8516: add i2c clock-div property arm64: dts: mediatek: mt8516: reserve 192 KiB for TF-A dt-bindings: mediatek,mt6779-keypad: add more compatibles arm64: dts: mediatek: add per-SoC compatibles for keypad nodes arm64: dts: mediatek: mt8516: add keypad node Varadarajan Narayanan (2): arm64: dts: qcom: ipq5424: Add LLCC/system-cache-controller arm64: dts: qcom: ipq5424: Add USB controller and phy nodes Vasily Khoruzhick (2): dt-bindings: clock: sunxi: Export PLL_VIDEO_2X and PLL_MIPI arm64: dts: allwinner: a64: explicitly assign clock parent for TCON0 Vibhore Vardhan (1): arm64: dts: ti: k3-am62a-wakeup: Configure ti-sysc for wkup_uart0 Viken Dadhaniya (1): arm64: dts: qcom: qcs615: Add QUPv3 configuration Vladimir Zapolskiy (3): arm64: dts: qcom: sc8280xp: Fix interrupt type of camss interrupts arm64: dts: qcom: sdm845: Fix interrupt types of camss interrupts arm64: dts: qcom: sm8250: Fix interrupt types of camss interrupts Wadim Egorov (4): arm64: dts: ti: k3-am62x-phyboard-lyra: Set RGB input to 16-bit for HDMI bridge arm64: dts: ti: k3-am62x-phyboard-lyra: Add HDMI bridge regulators arm64: dts: ti: k3-am62-phycore-som: Define vcc-supply for I2C EEPROM arm64: dts: ti: am62-phyboard-lyra: Provide a vcc-supply for the I2C EEPROM Wei Fang (2): arm64: dts: imx95: add NETC related nodes arm64: dts: imx95-19x19-evk: add ENETC 0 support Wojciech Macek (2): dt-bindings: arm: mediatek: Add MT8186 Starmie Chromebooks arm64: dts: mediatek: mt8186: Add Starmie device Wolfram Sang (1): arm64: dts: renesas: rzg3s-smarc: Enable I2C1 and connected power monitor Xin Liu (1): arm64: dts: qcom: qcs8300: Add watchdog node Yang Chen (7): ARM: dts: aspeed: minerva: Revise the SGPIO line name ARM: dts: aspeed: minerva: change the i2c mux number for FCBs ARM: dts: aspeed: minerva: add fru device for other blades ARM: dts: aspeed: minerva: add i/o expanders on bus 0 ARM: dts: aspeed: minerva: add i/o expanders on each FCB ARM: dts: aspeed: minerva: add bmc ready led setting ARM: dts: aspeed: minerva: add second source RTC Yijie Yang (2): arm64: dts: qcom: qcs8300: add the first 2.5G ethernet arm64: dts: qcom: qcs8300-ride: enable ethernet0 Yuanfang Zhang (1): arm64: dts: qcom: sm8650: Add coresight nodes Yuanjie Yang (2): arm64: dts: qcom: qcs615: add SDHC1 and SDHC2 arm64: dts: qcom: qcs615-ride: enable SDHC1 and SDHC2 Yuvaraj Ranganathan (3): arm64: dts: qcom: qcs8300: add QCrypto nodes arm64: dts: qcom: qcs8300: add TRNG node arm64: dts: qcom: qcs8300: enable the inline crypto engine Zhengqiao Xia (4): dt-bindings: arm: mediatek: Add MT8186 Chinchou Chromebook arm64: dts: mediatek: Add MT8186 Chinchou Chromebooks arm64: dts: mediatek: Add extcon node for DP bridge arm64: dts: mediatek: Modify audio codec name for pmic devi priya (2): arm64: dts: qcom: ipq9574: Add PCIe PHYs and controller nodes arm64: dts: qcom: ipq9574: Enable PCIe PHYs and controllers .../devicetree/bindings/arm/aspeed/aspeed.yaml | 2 + .../devicetree/bindings/arm/atmel-at91.yaml | 7 + .../devicetree/bindings/arm/atmel-sysregs.txt | 14 +- .../devicetree/bindings/arm/bcm/brcm,bcmbca.yaml | 2 + Documentation/devicetree/bindings/arm/fsl.yaml | 9 + .../devicetree/bindings/arm/mediatek.yaml | 65 +- .../devicetree/bindings/arm/qcom-soc.yaml | 9 +- Documentation/devicetree/bindings/arm/qcom.yaml | 64 + .../devicetree/bindings/arm/rockchip.yaml | 94 +- .../bindings/arm/samsung/samsung-boards.yaml | 3 + .../devicetree/bindings/arm/stm32/stm32.yaml | 7 + .../bindings/clock/qcom,ipq9574-cmn-pll.yaml | 77 + .../devicetree/bindings/clock/qcom,qcs615-gcc.yaml | 59 + .../bindings/clock/qcom,sm8550-dispcc.yaml | 4 +- .../bindings/clock/qcom,sm8550-tcsr.yaml | 2 + .../devicetree/bindings/clock/qcom,sm8750-gcc.yaml | 62 + .../bindings/clock/renesas,rzv2h-cpg.yaml | 15 +- .../bindings/clock/samsung,exynos990-clock.yaml | 121 + .../bindings/display/mediatek/mediatek,ovl.yaml | 12 +- .../devicetree/bindings/gpu/arm,mali-utgard.yaml | 1 + .../bindings/input/mediatek,mt6779-keypad.yaml | 3 + .../bindings/interconnect/qcom,sm8750-rpmh.yaml | 136 + .../bindings/pinctrl/renesas,rzg2l-pinctrl.yaml | 7 +- .../soc/amlogic/amlogic,meson-gx-hhi-sysctrl.yaml | 14 + .../devicetree/bindings/soc/renesas/renesas.yaml | 33 +- .../devicetree/bindings/soc/rockchip/grf.yaml | 1 + .../devicetree/bindings/soc/ti/ti,pruss.yaml | 10 + .../sram/allwinner,sun4i-a10-system-control.yaml | 4 +- .../devicetree/bindings/vendor-prefixes.yaml | 2 + MAINTAINERS | 16 +- .../dts/allwinner/suniv-f1c100s-licheepi-nano.dts | 8 + arch/arm/boot/dts/allwinner/suniv-f1c100s.dtsi | 24 + arch/arm/boot/dts/amlogic/meson.dtsi | 4 - arch/arm/boot/dts/aspeed/Makefile | 2 + .../dts/aspeed/aspeed-bmc-ampere-mtjefferson.dts | 622 ++ .../dts/aspeed/aspeed-bmc-ampere-mtmitchell.dts | 18 +- .../dts/aspeed/aspeed-bmc-facebook-catalina.dts | 191 +- .../boot/dts/aspeed/aspeed-bmc-facebook-harma.dts | 45 +- .../dts/aspeed/aspeed-bmc-facebook-minerva.dts | 998 +++- .../dts/aspeed/aspeed-bmc-facebook-yosemite4.dts | 1011 +++- .../boot/dts/aspeed/aspeed-bmc-ibm-blueridge.dts | 46 +- .../arm/boot/dts/aspeed/aspeed-bmc-ibm-everest.dts | 27 + arch/arm/boot/dts/aspeed/aspeed-bmc-ibm-fuji.dts | 111 +- .../arm/boot/dts/aspeed/aspeed-bmc-ibm-rainier.dts | 17 +- arch/arm/boot/dts/aspeed/aspeed-bmc-ibm-sbp1.dts | 6086 ++++++++++++++++++++ .../arm/boot/dts/aspeed/aspeed-bmc-ibm-system1.dts | 31 +- arch/arm/boot/dts/aspeed/aspeed-bmc-quanta-s6q.dts | 8 +- .../arm/boot/dts/aspeed/aspeed-bmc-vegman-rx20.dts | 6 +- arch/arm/boot/dts/aspeed/aspeed-bmc-vegman.dtsi | 2 +- arch/arm/boot/dts/broadcom/Makefile | 1 + .../arm/boot/dts/broadcom/bcm53015-meraki-mr26.dts | 20 + .../dts/broadcom/bcm53340-ubnt-unifi-switch8.dts | 1 - .../boot/dts/broadcom/bcm6846-genexis-xg6846b.dts | 244 + arch/arm/boot/dts/broadcom/bcm6846.dtsi | 120 + arch/arm/boot/dts/broadcom/bcm953012hr.dts | 1 - arch/arm/boot/dts/broadcom/bcm953012k.dts | 1 - arch/arm/boot/dts/broadcom/bcm958522er.dts | 1 - arch/arm/boot/dts/broadcom/bcm958525er.dts | 1 - arch/arm/boot/dts/broadcom/bcm958525xmc.dts | 1 - arch/arm/boot/dts/broadcom/bcm958622hr.dts | 1 - arch/arm/boot/dts/broadcom/bcm958623hr.dts | 1 - arch/arm/boot/dts/broadcom/bcm958625hr.dts | 1 - arch/arm/boot/dts/broadcom/bcm958625k.dts | 1 - arch/arm/boot/dts/broadcom/bcm988312hr.dts | 1 - .../boot/dts/intel/socfpga/socfpga_arria10.dtsi | 6 +- .../dts/intel/socfpga/socfpga_cyclone5_mcvevk.dts | 2 - .../dts/intel/socfpga/socfpga_cyclone5_socdk.dts | 6 - arch/arm/boot/dts/marvell/mmp2-olpc-xo-1-75.dts | 4 +- arch/arm/boot/dts/mediatek/mt7623.dtsi | 2 +- arch/arm/boot/dts/microchip/Makefile | 3 + .../boot/dts/microchip/at91-sam9x75_curiosity.dts | 54 +- .../boot/dts/microchip/at91-sama5d27_wlsom1_ek.dts | 1 + .../boot/dts/microchip/at91-sama5d29_curiosity.dts | 1 + .../boot/dts/microchip/at91-sama7d65_curiosity.dts | 89 + arch/arm/boot/dts/microchip/sam9x60.dtsi | 12 + arch/arm/boot/dts/microchip/sam9x7.dtsi | 38 + arch/arm/boot/dts/microchip/sama7d65-pinfunc.h | 947 +++ arch/arm/boot/dts/microchip/sama7d65.dtsi | 144 + arch/arm/boot/dts/nuvoton/nuvoton-npcm730-gbs.dts | 6 +- .../dts/nuvoton/nuvoton-npcm750-runbmc-olympus.dts | 2 +- arch/arm/boot/dts/nvidia/tegra124-nyan.dtsi | 2 + arch/arm/boot/dts/nxp/imx/imx51-zii-rdu1.dts | 2 +- arch/arm/boot/dts/nxp/imx/imx51-zii-scu2-mezz.dts | 2 +- arch/arm/boot/dts/nxp/imx/imx6q-bx50v3.dtsi | 2 +- arch/arm/boot/dts/nxp/imx/imx6qdl-apalis.dtsi | 2 +- arch/arm/boot/dts/nxp/imx/imx6qdl-sabresd.dtsi | 5 +- arch/arm/boot/dts/nxp/imx/imx6qdl.dtsi | 6 +- arch/arm/boot/dts/nxp/imx/imx6sl-evk.dts | 2 +- arch/arm/boot/dts/nxp/imx/imx6sl.dtsi | 6 +- arch/arm/boot/dts/nxp/imx/imx6sll-evk.dts | 2 +- arch/arm/boot/dts/nxp/imx/imx6sx-sdb.dtsi | 2 +- arch/arm/boot/dts/nxp/imx/imx6sx.dtsi | 6 +- arch/arm/boot/dts/nxp/imx/imx6ul-14x14-evk.dtsi | 2 +- arch/arm/boot/dts/nxp/imx/imx7-mba7.dtsi | 61 +- arch/arm/boot/dts/nxp/imx/imx7-tqma7.dtsi | 3 +- arch/arm/boot/dts/nxp/imx/imx7d-mba7.dts | 3 +- arch/arm/boot/dts/nxp/imx/imx7d-sdb.dts | 2 +- arch/arm/boot/dts/qcom/qcom-sdx55.dtsi | 7 +- arch/arm/boot/dts/qcom/qcom-sdx65.dtsi | 6 + arch/arm/boot/dts/renesas/r7s72100.dtsi | 10 + arch/arm/boot/dts/samsung/exynos4212-tab3.dtsi | 31 +- arch/arm/boot/dts/st/Makefile | 1 + arch/arm/boot/dts/st/stih410-b2260.dts | 4 + arch/arm/boot/dts/st/stih410.dtsi | 34 + arch/arm/boot/dts/st/stm32mp131.dtsi | 40 + arch/arm/boot/dts/st/stm32mp135f-dk.dts | 12 + arch/arm/boot/dts/st/stm32mp13xx-dhcor-som.dtsi | 16 +- arch/arm/boot/dts/st/stm32mp151.dtsi | 43 +- arch/arm/boot/dts/st/stm32mp153c-lxa-tac-gen3.dts | 267 + arch/arm/boot/dts/st/stm32mp157c-ev1.dts | 9 + arch/arm/boot/dts/st/stm32mp157c-lxa-tac-gen1.dts | 84 + arch/arm/boot/dts/st/stm32mp157c-lxa-tac-gen2.dts | 84 + arch/arm/boot/dts/st/stm32mp15xc-lxa-tac.dtsi | 100 +- arch/arm/boot/dts/st/stm32mp15xx-dhcom-drc02.dtsi | 12 - arch/arm/boot/dts/st/stm32mp15xx-dhcom-pdk2.dtsi | 10 - .../arm/boot/dts/st/stm32mp15xx-dhcom-picoitx.dtsi | 10 - arch/arm/boot/dts/st/stm32mp15xx-dhcom-som.dtsi | 7 + arch/arm/boot/dts/st/stm32mp15xx-dkx.dtsi | 18 + arch/arm/boot/dts/ti/omap/am437x-l4.dtsi | 18 +- arch/arm/boot/dts/ti/omap/dra7-l4.dtsi | 2 + arch/arm/boot/dts/ti/omap/omap3-gta04.dtsi | 16 +- arch/arm64/boot/dts/allwinner/sun50i-a100.dtsi | 33 + .../boot/dts/allwinner/sun50i-a64-pinebook.dts | 2 + .../boot/dts/allwinner/sun50i-a64-teres-i.dts | 2 + arch/arm64/boot/dts/allwinner/sun50i-a64.dtsi | 2 + .../boot/dts/allwinner/sun50i-h313-tanix-tx1.dts | 1 + .../boot/dts/altera/socfpga_stratix10_swvp.dts | 1 - arch/arm64/boot/dts/amlogic/meson-gxbb-p20x.dtsi | 3 +- .../boot/dts/amlogic/meson-gxl-s905d-p230.dts | 3 +- .../boot/dts/amlogic/meson-gxl-s905d-p231.dts | 3 +- .../boot/dts/amlogic/meson-gxl-s905x-p212.dtsi | 3 +- arch/arm64/boot/dts/amlogic/meson-gxm-q200.dts | 3 +- arch/arm64/boot/dts/amlogic/meson-gxm-q201.dts | 3 +- arch/arm64/boot/dts/broadcom/Makefile | 1 + arch/arm64/boot/dts/broadcom/bcm2712-d-rpi-5-b.dts | 37 + arch/arm64/boot/dts/broadcom/bcm2712-rpi-5-b.dts | 42 + arch/arm64/boot/dts/broadcom/bcm2712.dtsi | 193 +- arch/arm64/boot/dts/broadcom/bcmbca/Makefile | 1 + .../dts/broadcom/bcmbca/bcm4906-netgear-r8000p.dts | 12 +- .../dts/broadcom/bcmbca/bcm4906-zyxel-ex3510b.dts | 196 + arch/arm64/boot/dts/broadcom/bcmbca/bcm4908.dtsi | 18 +- .../arm64/boot/dts/broadcom/northstar2/ns2-svk.dts | 2 - .../arm64/boot/dts/broadcom/northstar2/ns2-xmc.dts | 1 - arch/arm64/boot/dts/broadcom/northstar2/ns2.dtsi | 2 - arch/arm64/boot/dts/exynos/Makefile | 4 + arch/arm64/boot/dts/exynos/exynos850-e850-96.dts | 15 +- arch/arm64/boot/dts/exynos/exynos8895.dtsi | 82 +- arch/arm64/boot/dts/exynos/exynos9810-pinctrl.dtsi | 503 ++ arch/arm64/boot/dts/exynos/exynos9810-starlte.dts | 119 + arch/arm64/boot/dts/exynos/exynos9810.dtsi | 273 + arch/arm64/boot/dts/exynos/exynos990-r8s.dts | 115 + .../boot/dts/exynos/exynos990-x1s-common.dtsi | 98 + arch/arm64/boot/dts/exynos/exynos990-x1s.dts | 28 + arch/arm64/boot/dts/exynos/exynos990-x1slte.dts | 28 + arch/arm64/boot/dts/exynos/exynos990.dtsi | 50 +- arch/arm64/boot/dts/exynos/exynosautov920.dtsi | 83 + arch/arm64/boot/dts/exynos/google/gs101-oriole.dts | 104 + arch/arm64/boot/dts/exynos/google/gs101.dtsi | 5 +- arch/arm64/boot/dts/freescale/Makefile | 13 + arch/arm64/boot/dts/freescale/imx8mm-phg.dts | 2 +- .../dts/freescale/imx8mn-bsh-smm-s2-display.dtsi | 28 + .../freescale/imx8mp-aristainetos3-adpismarc.dts | 37 + .../imx8mp-aristainetos3-helios-lvds.dtso | 113 + .../dts/freescale/imx8mp-aristainetos3-helios.dts | 98 + .../freescale/imx8mp-aristainetos3-proton2s.dts | 161 + .../freescale/imx8mp-aristainetos3a-som-v1.dtsi | 1107 ++++ .../freescale/imx8mp-evk-imx-lvds-hdmi-common.dtsi | 29 + .../imx8mp-evk-lvds0-imx-dlvds-hdmi-channel0.dtso | 44 + .../imx8mp-evk-lvds0-imx-lvds-hdmi-common.dtsi | 43 + .../freescale/imx8mp-evk-lvds0-imx-lvds-hdmi.dtso | 28 + .../imx8mp-evk-lvds1-imx-dlvds-hdmi-channel0.dtso | 44 + .../imx8mp-evk-lvds1-imx-lvds-hdmi-common.dtsi | 43 + .../freescale/imx8mp-evk-lvds1-imx-lvds-hdmi.dtso | 28 + arch/arm64/boot/dts/freescale/imx8mp-evk.dts | 6 + .../freescale/imx8mp-skov-revb-mi1010ait-1cp1.dts | 8 +- .../boot/dts/freescale/imx8mq-librem5-devkit.dts | 2 +- arch/arm64/boot/dts/freescale/imx8mq-librem5.dtsi | 2 +- .../arm64/boot/dts/freescale/imx8mq-zii-ultra.dtsi | 2 - arch/arm64/boot/dts/freescale/imx93-11x11-evk.dts | 8 + arch/arm64/boot/dts/freescale/imx93-14x14-evk.dts | 92 + arch/arm64/boot/dts/freescale/imx93-9x9-qsb.dts | 14 + .../dts/freescale/imx93-tqma9352-mba93xxca.dts | 8 +- .../dts/freescale/imx93-tqma9352-mba93xxla.dts | 8 +- arch/arm64/boot/dts/freescale/imx95-19x19-evk.dts | 52 + arch/arm64/boot/dts/freescale/imx95.dtsi | 93 + arch/arm64/boot/dts/hisilicon/hi6220.dtsi | 2 - arch/arm64/boot/dts/intel/socfpga_agilex.dtsi | 3 + arch/arm64/boot/dts/intel/socfpga_agilex5.dtsi | 24 +- arch/arm64/boot/dts/marvell/armada-7040-db.dts | 1 + .../boot/dts/marvell/armada-7040-mochabin.dts | 2 + .../dts/marvell/armada-8040-clearfog-gt-8k.dts | 1 + arch/arm64/boot/dts/marvell/armada-8040-db.dts | 5 +- arch/arm64/boot/dts/marvell/armada-8040-mcbin.dtsi | 3 +- .../boot/dts/marvell/armada-8040-puzzle-m801.dts | 2 + arch/arm64/boot/dts/marvell/armada-cp11x.dtsi | 2 + arch/arm64/boot/dts/marvell/cn9130-crb-B.dts | 1 + arch/arm64/boot/dts/marvell/cn9131-cf-solidwan.dts | 4 +- arch/arm64/boot/dts/marvell/cn9131-db.dtsi | 1 + arch/arm64/boot/dts/marvell/cn9132-db.dtsi | 1 + arch/arm64/boot/dts/mediatek/Makefile | 19 +- arch/arm64/boot/dts/mediatek/mt2712-evb.dts | 1 + arch/arm64/boot/dts/mediatek/mt6359.dtsi | 1 + .../dts/mediatek/mt7986a-bananapi-bpi-r3-sata.dtso | 34 + .../dts/mediatek/mt7988a-bananapi-bpi-r4-emmc.dtso | 33 + .../dts/mediatek/mt7988a-bananapi-bpi-r4-sd.dtso | 31 + .../boot/dts/mediatek/mt7988a-bananapi-bpi-r4.dts | 398 ++ arch/arm64/boot/dts/mediatek/mt7988a.dtsi | 365 +- arch/arm64/boot/dts/mediatek/mt8173-elm.dtsi | 29 +- arch/arm64/boot/dts/mediatek/mt8173-evb.dts | 25 +- .../dts/mediatek/mt8183-kukui-jacuzzi-damu.dts | 4 + .../dts/mediatek/mt8183-kukui-jacuzzi-kenzo.dts | 15 + .../dts/mediatek/mt8183-kukui-jacuzzi-willow.dtsi | 15 + .../boot/dts/mediatek/mt8183-kukui-jacuzzi.dtsi | 2 - arch/arm64/boot/dts/mediatek/mt8183-kukui.dtsi | 9 +- arch/arm64/boot/dts/mediatek/mt8183-pumpkin.dts | 4 - arch/arm64/boot/dts/mediatek/mt8183.dtsi | 5 +- .../dts/mediatek/mt8186-corsola-chinchou-sku0.dts | 18 + .../dts/mediatek/mt8186-corsola-chinchou-sku1.dts | 35 + .../dts/mediatek/mt8186-corsola-chinchou-sku16.dts | 29 + .../boot/dts/mediatek/mt8186-corsola-chinchou.dtsi | 321 ++ .../dts/mediatek/mt8186-corsola-starmie-sku0.dts | 31 + .../dts/mediatek/mt8186-corsola-starmie-sku1.dts | 31 + .../boot/dts/mediatek/mt8186-corsola-starmie.dtsi | 472 ++ arch/arm64/boot/dts/mediatek/mt8186-corsola.dtsi | 8 +- arch/arm64/boot/dts/mediatek/mt8186.dtsi | 8 +- .../boot/dts/mediatek/mt8188-geralt-ciri-sku0.dts | 32 + .../boot/dts/mediatek/mt8188-geralt-ciri-sku1.dts | 59 + .../boot/dts/mediatek/mt8188-geralt-ciri-sku2.dts | 59 + .../boot/dts/mediatek/mt8188-geralt-ciri-sku3.dts | 32 + .../boot/dts/mediatek/mt8188-geralt-ciri-sku4.dts | 48 + .../boot/dts/mediatek/mt8188-geralt-ciri-sku5.dts | 72 + .../boot/dts/mediatek/mt8188-geralt-ciri-sku6.dts | 72 + .../boot/dts/mediatek/mt8188-geralt-ciri-sku7.dts | 48 + .../boot/dts/mediatek/mt8188-geralt-ciri.dtsi | 316 + arch/arm64/boot/dts/mediatek/mt8188-geralt.dtsi | 1156 ++++ arch/arm64/boot/dts/mediatek/mt8188.dtsi | 9 +- .../dts/mediatek/mt8192-asurada-hayato-r5-sku2.dts | 65 - .../dts/mediatek/mt8192-asurada-spherion-r4.dts | 78 - arch/arm64/boot/dts/mediatek/mt8192-asurada.dtsi | 3 - arch/arm64/boot/dts/mediatek/mt8195-cherry.dtsi | 2 - arch/arm64/boot/dts/mediatek/mt8195-demo.dts | 10 +- arch/arm64/boot/dts/mediatek/mt8195.dtsi | 5 +- arch/arm64/boot/dts/mediatek/mt8365-evk.dts | 1 + arch/arm64/boot/dts/mediatek/mt8365.dtsi | 3 +- .../boot/dts/mediatek/mt8390-genio-700-evk.dts | 48 + .../boot/dts/mediatek/mt8395-genio-1200-evk.dts | 2 - .../dts/mediatek/mt8395-kontron-3-5-sbc-i1200.dts | 1 + .../boot/dts/mediatek/mt8395-radxa-nio-12l.dts | 2 - arch/arm64/boot/dts/mediatek/mt8516.dtsi | 22 +- arch/arm64/boot/dts/mediatek/pumpkin-common.dtsi | 2 - arch/arm64/boot/dts/nvidia/tegra234.dtsi | 8 +- arch/arm64/boot/dts/qcom/Makefile | 12 + arch/arm64/boot/dts/qcom/ipq5332.dtsi | 2 +- arch/arm64/boot/dts/qcom/ipq5424-rdp466.dts | 169 + arch/arm64/boot/dts/qcom/ipq5424.dtsi | 519 ++ arch/arm64/boot/dts/qcom/ipq9574-rdp-common.dtsi | 24 +- arch/arm64/boot/dts/qcom/ipq9574-rdp433.dts | 113 + arch/arm64/boot/dts/qcom/ipq9574.dtsi | 449 +- .../boot/dts/qcom/msm8916-samsung-serranove.dts | 58 + arch/arm64/boot/dts/qcom/msm8916.dtsi | 2 +- arch/arm64/boot/dts/qcom/msm8917-xiaomi-riva.dts | 333 ++ arch/arm64/boot/dts/qcom/msm8917.dtsi | 1954 +++++++ arch/arm64/boot/dts/qcom/msm8939.dtsi | 2 +- .../dts/qcom/msm8994-huawei-angler-rev-101.dts | 21 +- .../boot/dts/qcom/msm8994-msft-lumia-octagon.dtsi | 5 - arch/arm64/boot/dts/qcom/msm8994.dtsi | 11 +- arch/arm64/boot/dts/qcom/msm8996-xiaomi-gemini.dts | 2 +- arch/arm64/boot/dts/qcom/msm8996.dtsi | 9 +- arch/arm64/boot/dts/qcom/pm660l.dtsi | 6 + arch/arm64/boot/dts/qcom/pm8150.dtsi | 2 - arch/arm64/boot/dts/qcom/pm8937.dtsi | 150 + arch/arm64/boot/dts/qcom/pmd8028.dtsi | 62 + arch/arm64/boot/dts/qcom/pmi8950.dtsi | 17 + arch/arm64/boot/dts/qcom/pmih0108.dtsi | 68 + arch/arm64/boot/dts/qcom/pmk8350.dtsi | 72 + arch/arm64/boot/dts/qcom/qcm6490-fairphone-fp5.dts | 101 +- arch/arm64/boot/dts/qcom/qcm6490-idp.dts | 8 + arch/arm64/boot/dts/qcom/qcm6490-shift-otter.dts | 2 - arch/arm64/boot/dts/qcom/qcs404.dtsi | 6 +- arch/arm64/boot/dts/qcom/qcs615-ride.dts | 343 ++ arch/arm64/boot/dts/qcom/qcs615.dtsi | 3670 ++++++++++++ arch/arm64/boot/dts/qcom/qcs6490-rb3gen2.dts | 41 + arch/arm64/boot/dts/qcom/qcs8300-ride.dts | 370 ++ arch/arm64/boot/dts/qcom/qcs8300.dtsi | 3548 ++++++++++++ arch/arm64/boot/dts/qcom/qcs8550-aim300.dtsi | 2 +- arch/arm64/boot/dts/qcom/qdu1000-idp.dts | 19 +- arch/arm64/boot/dts/qcom/qdu1000.dtsi | 16 + arch/arm64/boot/dts/qcom/qrb4210-rb2.dts | 61 +- arch/arm64/boot/dts/qcom/qrb5165-rb5.dts | 5 + arch/arm64/boot/dts/qcom/qru1000-idp.dts | 19 +- arch/arm64/boot/dts/qcom/sa8775p-ride.dtsi | 82 +- arch/arm64/boot/dts/qcom/sa8775p.dtsi | 406 +- arch/arm64/boot/dts/qcom/sar2130p-qar2130p.dts | 558 ++ arch/arm64/boot/dts/qcom/sar2130p.dtsi | 3123 ++++++++++ .../arm64/boot/dts/qcom/sc7180-trogdor-pompom.dtsi | 4 +- .../dts/qcom/sc7180-trogdor-quackingstick.dtsi | 1 + arch/arm64/boot/dts/qcom/sc7180.dtsi | 20 +- arch/arm64/boot/dts/qcom/sc7280.dtsi | 6 +- .../arm64/boot/dts/qcom/sc8180x-lenovo-flex-5g.dts | 4 - arch/arm64/boot/dts/qcom/sc8180x-primus.dts | 4 - arch/arm64/boot/dts/qcom/sc8180x.dtsi | 6 + .../boot/dts/qcom/sc8280xp-huawei-gaokun3.dts | 1318 +++++ .../boot/dts/qcom/sc8280xp-microsoft-blackrock.dts | 1325 +++++ arch/arm64/boot/dts/qcom/sc8280xp.dtsi | 52 +- arch/arm64/boot/dts/qcom/sdm450-lenovo-tbx605f.dts | 97 + arch/arm64/boot/dts/qcom/sdm630.dtsi | 4 + arch/arm64/boot/dts/qcom/sdm670-google-sargo.dts | 37 +- arch/arm64/boot/dts/qcom/sdm670.dtsi | 204 + .../qcom/sdm845-db845c-navigation-mezzanine.dtso | 42 - arch/arm64/boot/dts/qcom/sdm845-shift-axolotl.dts | 1 - arch/arm64/boot/dts/qcom/sdm845.dtsi | 24 +- arch/arm64/boot/dts/qcom/sdx75.dtsi | 6 +- arch/arm64/boot/dts/qcom/sm4250.dtsi | 39 + arch/arm64/boot/dts/qcom/sm4450.dtsi | 2 +- arch/arm64/boot/dts/qcom/sm6115.dtsi | 95 +- arch/arm64/boot/dts/qcom/sm6125.dtsi | 4 +- arch/arm64/boot/dts/qcom/sm6350.dtsi | 8 +- arch/arm64/boot/dts/qcom/sm6375.dtsi | 12 +- arch/arm64/boot/dts/qcom/sm7225-fairphone-fp4.dts | 2 +- arch/arm64/boot/dts/qcom/sm8150-hdk.dts | 5 + .../boot/dts/qcom/sm8150-microsoft-surface-duo.dts | 9 +- arch/arm64/boot/dts/qcom/sm8150-mtp.dts | 5 + .../boot/dts/qcom/sm8150-sony-xperia-kumano.dtsi | 5 + arch/arm64/boot/dts/qcom/sm8150.dtsi | 4 + arch/arm64/boot/dts/qcom/sm8250-hdk.dts | 5 + arch/arm64/boot/dts/qcom/sm8250-mtp.dts | 5 + .../boot/dts/qcom/sm8250-sony-xperia-edo.dtsi | 5 + .../boot/dts/qcom/sm8250-xiaomi-elish-common.dtsi | 120 + arch/arm64/boot/dts/qcom/sm8250-xiaomi-pipa.dts | 5 + arch/arm64/boot/dts/qcom/sm8250.dtsi | 34 +- arch/arm64/boot/dts/qcom/sm8350-hdk.dts | 7 + arch/arm64/boot/dts/qcom/sm8350.dtsi | 498 +- arch/arm64/boot/dts/qcom/sm8450.dtsi | 1000 +++- arch/arm64/boot/dts/qcom/sm8550-hdk.dts | 2 +- arch/arm64/boot/dts/qcom/sm8550-mtp.dts | 2 +- arch/arm64/boot/dts/qcom/sm8550-qrd.dts | 2 +- arch/arm64/boot/dts/qcom/sm8550-samsung-q5q.dts | 2 +- .../dts/qcom/sm8550-sony-xperia-yodo-pdx234.dts | 2 +- arch/arm64/boot/dts/qcom/sm8550.dtsi | 296 +- arch/arm64/boot/dts/qcom/sm8650-hdk.dts | 2 +- arch/arm64/boot/dts/qcom/sm8650-mtp.dts | 2 +- arch/arm64/boot/dts/qcom/sm8650-qrd.dts | 2 +- arch/arm64/boot/dts/qcom/sm8650.dtsi | 504 +- arch/arm64/boot/dts/qcom/sm8750-mtp.dts | 794 +++ arch/arm64/boot/dts/qcom/sm8750-pmics.dtsi | 188 + arch/arm64/boot/dts/qcom/sm8750-qrd.dts | 792 +++ arch/arm64/boot/dts/qcom/sm8750.dtsi | 2907 ++++++++++ arch/arm64/boot/dts/qcom/x1e001de-devkit.dts | 1371 +++++ .../dts/qcom/x1e78100-lenovo-thinkpad-t14s.dts | 320 +- .../boot/dts/qcom/x1e80100-asus-vivobook-s15.dts | 60 +- arch/arm64/boot/dts/qcom/x1e80100-crd.dts | 14 +- .../boot/dts/qcom/x1e80100-dell-xps13-9345.dts | 305 +- .../boot/dts/qcom/x1e80100-hp-omnibook-x14.dts | 1693 ++++++ .../boot/dts/qcom/x1e80100-lenovo-yoga-slim7x.dts | 52 +- .../boot/dts/qcom/x1e80100-microsoft-romulus.dtsi | 527 +- arch/arm64/boot/dts/qcom/x1e80100-pmics.dtsi | 4 + arch/arm64/boot/dts/qcom/x1e80100-qcp.dts | 298 +- arch/arm64/boot/dts/qcom/x1e80100.dtsi | 2450 +++++++- arch/arm64/boot/dts/renesas/Makefile | 12 +- .../boot/dts/renesas/r8a779a0-falcon-ethernet.dtsi | 242 + arch/arm64/boot/dts/renesas/r8a779a0.dtsi | 10 - arch/arm64/boot/dts/renesas/r8a779g0.dtsi | 40 + .../dts/renesas/r8a779g2-white-hawk-single.dts | 62 +- .../dts/renesas/r8a779g3-white-hawk-single.dts | 16 + arch/arm64/boot/dts/renesas/r8a779g3.dtsi | 12 + .../boot/dts/renesas/r8a779h0-gray-hawk-single.dts | 298 +- arch/arm64/boot/dts/renesas/r8a779h0.dtsi | 73 + arch/arm64/boot/dts/renesas/r9a08g045.dtsi | 237 + arch/arm64/boot/dts/renesas/r9a09g047.dtsi | 387 ++ arch/arm64/boot/dts/renesas/r9a09g047e37.dtsi | 18 + arch/arm64/boot/dts/renesas/r9a09g047e57-smarc.dts | 31 + arch/arm64/boot/dts/renesas/r9a09g047e57.dtsi | 13 + .../boot/dts/renesas/r9a09g057h44-rzv2h-evk.dts | 36 +- arch/arm64/boot/dts/renesas/renesas-smarc2.dtsi | 24 + arch/arm64/boot/dts/renesas/rzg3e-smarc-som.dtsi | 28 + arch/arm64/boot/dts/renesas/rzg3s-smarc-som.dtsi | 56 +- arch/arm64/boot/dts/renesas/rzg3s-smarc.dtsi | 83 +- arch/arm64/boot/dts/renesas/ulcb-kf.dtsi | 18 +- arch/arm64/boot/dts/renesas/ulcb.dtsi | 5 + ...a7212.dtso => white-hawk-ard-audio-da7212.dtso} | 6 +- .../arm64/boot/dts/renesas/white-hawk-csi-dsi.dtsi | 2 + arch/arm64/boot/dts/renesas/white-hawk-single.dtsi | 73 + arch/arm64/boot/dts/rockchip/Makefile | 7 + arch/arm64/boot/dts/rockchip/rk3308-rock-s0.dts | 25 +- arch/arm64/boot/dts/rockchip/rk3328-a1.dts | 1 - arch/arm64/boot/dts/rockchip/rk3328-nanopi-r2.dtsi | 1 - .../boot/dts/rockchip/rk3328-orangepi-r1-plus.dtsi | 1 - arch/arm64/boot/dts/rockchip/rk3328-rock-pi-e.dts | 3 - arch/arm64/boot/dts/rockchip/rk3328-rock64.dts | 1 - arch/arm64/boot/dts/rockchip/rk3399-puma.dtsi | 2 +- .../dts/rockchip/rk3566-bigtreetech-cb2-manta.dts | 10 + .../boot/dts/rockchip/rk3566-bigtreetech-cb2.dtsi | 904 +++ .../boot/dts/rockchip/rk3566-bigtreetech-pi2.dts | 10 + arch/arm64/boot/dts/rockchip/rk3568-mecsbc.dts | 19 +- arch/arm64/boot/dts/rockchip/rk3568-qnap-ts433.dts | 61 + .../boot/dts/rockchip/rk3568-wolfvision-pf5.dts | 10 +- arch/arm64/boot/dts/rockchip/rk3576-evb1-v10.dts | 731 +++ arch/arm64/boot/dts/rockchip/rk3576.dtsi | 169 + arch/arm64/boot/dts/rockchip/rk3582-radxa-e52c.dts | 743 +++ arch/arm64/boot/dts/rockchip/rk3588-base.dtsi | 3 +- .../boot/dts/rockchip/rk3588-edgeble-neu6a-io.dtsi | 81 +- arch/arm64/boot/dts/rockchip/rk3588-evb1-v10.dts | 82 + arch/arm64/boot/dts/rockchip/rk3588-extra.dtsi | 4 + .../dts/rockchip/rk3588-firefly-core-3588j.dtsi | 443 ++ .../boot/dts/rockchip/rk3588-firefly-itx-3588j.dts | 702 +++ .../arm64/boot/dts/rockchip/rk3588-h96-max-v58.dts | 802 +++ .../dts/rockchip/rk3588-orangepi-5-compact.dtsi | 151 + .../boot/dts/rockchip/rk3588-orangepi-5-max.dts | 60 + .../boot/dts/rockchip/rk3588-orangepi-5-plus.dts | 894 +-- .../arm64/boot/dts/rockchip/rk3588-orangepi-5.dtsi | 805 +++ .../arm64/boot/dts/rockchip/rk3588s-nanopi-r6.dtsi | 18 + .../boot/dts/socionext/uniphier-ld11-global.dts | 2 +- .../boot/dts/socionext/uniphier-ld20-global.dts | 2 +- arch/arm64/boot/dts/sprd/sc2731.dtsi | 6 +- arch/arm64/boot/dts/sprd/sc9863a.dtsi | 14 +- arch/arm64/boot/dts/sprd/sp9860g-1h10.dts | 9 +- arch/arm64/boot/dts/st/stm32mp251.dtsi | 234 + arch/arm64/boot/dts/st/stm32mp257f-ev1.dts | 97 + arch/arm64/boot/dts/ti/Makefile | 19 +- arch/arm64/boot/dts/ti/k3-am62-main.dtsi | 1 - arch/arm64/boot/dts/ti/k3-am62-phycore-som.dtsi | 11 + arch/arm64/boot/dts/ti/k3-am625-beagleplay.dts | 2 +- arch/arm64/boot/dts/ti/k3-am625-sk.dts | 7 - arch/arm64/boot/dts/ti/k3-am62a-main.dtsi | 1 - arch/arm64/boot/dts/ti/k3-am62a-wakeup.dtsi | 36 +- .../boot/dts/ti/k3-am62p-j722s-common-main.dtsi | 5 + arch/arm64/boot/dts/ti/k3-am62p5-sk.dts | 4 + arch/arm64/boot/dts/ti/k3-am62x-phyboard-lyra.dtsi | 24 + arch/arm64/boot/dts/ti/k3-am62x-sk-common.dtsi | 6 +- arch/arm64/boot/dts/ti/k3-am64-main.dtsi | 22 +- ...-pcie.dtso => k3-am642-hummingboard-t-pcie.dts} | 14 +- ...-usb3.dtso => k3-am642-hummingboard-t-usb3.dts} | 13 +- .../boot/dts/ti/k3-am642-tqma64xxl-mbax4xxl.dts | 6 - arch/arm64/boot/dts/ti/k3-am67a-beagley-ai.dts | 158 + .../dts/ti/k3-am68-sk-base-board-pcie1-ep.dtso | 53 + arch/arm64/boot/dts/ti/k3-am69-sk-pcie0-ep.dtso | 53 + arch/arm64/boot/dts/ti/k3-am69-sk.dts | 41 + .../boot/dts/ti/k3-j7200-common-proc-board.dts | 4 + arch/arm64/boot/dts/ti/k3-j7200-mcu-wakeup.dtsi | 7 + arch/arm64/boot/dts/ti/k3-j721e-evm-pcie1-ep.dtso | 53 + arch/arm64/boot/dts/ti/k3-j722s-evm.dts | 102 + .../boot/dts/ti/k3-j784s4-j742s2-evm-common.dtsi | 8 + .../boot/dts/ti/k3-j784s4-j742s2-main-common.dtsi | 22 +- .../dts/ti/k3-j784s4-j742s2-mcu-wakeup-common.dtsi | 12 +- arch/arm64/boot/dts/ti/k3-pinctrl.h | 19 + arch/riscv/boot/dts/starfive/jh7110-milkv-mars.dts | 18 +- .../boot/dts/starfive/jh7110-pine64-star64.dts | 18 +- arch/riscv/boot/dts/thead/th1520.dtsi | 16 + include/dt-bindings/clock/qcom,ipq-cmn-pll.h | 22 + include/dt-bindings/clock/qcom,qcs615-gcc.h | 211 + include/dt-bindings/clock/qcom,sm8750-dispcc.h | 112 + include/dt-bindings/clock/qcom,sm8750-gcc.h | 226 + include/dt-bindings/clock/qcom,sm8750-tcsr.h | 15 + include/dt-bindings/clock/renesas,r9a09g047-cpg.h | 21 + include/dt-bindings/clock/samsung,exynos990.h | 236 + include/dt-bindings/clock/sun50i-a64-ccu.h | 2 + .../dt-bindings/interconnect/qcom,sm8750-rpmh.h | 143 + .../pinctrl/renesas,r9a09g047-pinctrl.h | 41 + .../pinctrl/renesas,r9a09g057-pinctrl.h | 31 + 459 files changed, 62645 insertions(+), 3226 deletions(-) create mode 100644 Documentation/devicetree/bindings/clock/qcom,ipq9574-cmn-pll.yaml create mode 100644 Documentation/devicetree/bindings/clock/qcom,qcs615-gcc.yaml create mode 100644 Documentation/devicetree/bindings/clock/qcom,sm8750-gcc.yaml create mode 100644 Documentation/devicetree/bindings/clock/samsung,exynos990-clock.yaml create mode 100644 Documentation/devicetree/bindings/interconnect/qcom,sm8750-rpmh.yaml create mode 100644 arch/arm/boot/dts/aspeed/aspeed-bmc-ampere-mtjefferson.dts create mode 100644 arch/arm/boot/dts/aspeed/aspeed-bmc-ibm-sbp1.dts create mode 100644 arch/arm/boot/dts/broadcom/bcm6846-genexis-xg6846b.dts create mode 100644 arch/arm/boot/dts/microchip/at91-sama7d65_curiosity.dts create mode 100644 arch/arm/boot/dts/microchip/sama7d65-pinfunc.h create mode 100644 arch/arm/boot/dts/microchip/sama7d65.dtsi create mode 100644 arch/arm/boot/dts/st/stm32mp153c-lxa-tac-gen3.dts create mode 100644 arch/arm64/boot/dts/broadcom/bcm2712-d-rpi-5-b.dts create mode 100644 arch/arm64/boot/dts/broadcom/bcmbca/bcm4906-zyxel-ex3510b.dts create mode 100644 arch/arm64/boot/dts/exynos/exynos9810-pinctrl.dtsi create mode 100644 arch/arm64/boot/dts/exynos/exynos9810-starlte.dts create mode 100644 arch/arm64/boot/dts/exynos/exynos9810.dtsi create mode 100644 arch/arm64/boot/dts/exynos/exynos990-r8s.dts create mode 100644 arch/arm64/boot/dts/exynos/exynos990-x1s-common.dtsi create mode 100644 arch/arm64/boot/dts/exynos/exynos990-x1s.dts create mode 100644 arch/arm64/boot/dts/exynos/exynos990-x1slte.dts create mode 100644 arch/arm64/boot/dts/freescale/imx8mp-aristainetos3-adpismarc.dts create mode 100644 arch/arm64/boot/dts/freescale/imx8mp-aristainetos3-helios-lvds.dtso create mode 100644 arch/arm64/boot/dts/freescale/imx8mp-aristainetos3-helios.dts create mode 100644 arch/arm64/boot/dts/freescale/imx8mp-aristainetos3-proton2s.dts create mode 100644 arch/arm64/boot/dts/freescale/imx8mp-aristainetos3a-som-v1.dtsi create mode 100644 arch/arm64/boot/dts/freescale/imx8mp-evk-imx-lvds-hdmi-common.dtsi create mode 100644 arch/arm64/boot/dts/freescale/imx8mp-evk-lvds0-imx-dlvds-hdmi-channel0.dtso create mode 100644 arch/arm64/boot/dts/freescale/imx8mp-evk-lvds0-imx-lvds-hdmi-common.dtsi create mode 100644 arch/arm64/boot/dts/freescale/imx8mp-evk-lvds0-imx-lvds-hdmi.dtso create mode 100644 arch/arm64/boot/dts/freescale/imx8mp-evk-lvds1-imx-dlvds-hdmi-channel0.dtso create mode 100644 arch/arm64/boot/dts/freescale/imx8mp-evk-lvds1-imx-lvds-hdmi-common.dtsi create mode 100644 arch/arm64/boot/dts/freescale/imx8mp-evk-lvds1-imx-lvds-hdmi.dtso create mode 100644 arch/arm64/boot/dts/mediatek/mt7986a-bananapi-bpi-r3-sata.dtso create mode 100644 arch/arm64/boot/dts/mediatek/mt7988a-bananapi-bpi-r4-emmc.dtso create mode 100644 arch/arm64/boot/dts/mediatek/mt7988a-bananapi-bpi-r4-sd.dtso create mode 100644 arch/arm64/boot/dts/mediatek/mt8186-corsola-chinchou-sku0.dts create mode 100644 arch/arm64/boot/dts/mediatek/mt8186-corsola-chinchou-sku1.dts create mode 100644 arch/arm64/boot/dts/mediatek/mt8186-corsola-chinchou-sku16.dts create mode 100644 arch/arm64/boot/dts/mediatek/mt8186-corsola-chinchou.dtsi create mode 100644 arch/arm64/boot/dts/mediatek/mt8186-corsola-starmie-sku0.dts create mode 100644 arch/arm64/boot/dts/mediatek/mt8186-corsola-starmie-sku1.dts create mode 100644 arch/arm64/boot/dts/mediatek/mt8186-corsola-starmie.dtsi create mode 100644 arch/arm64/boot/dts/mediatek/mt8188-geralt-ciri-sku0.dts create mode 100644 arch/arm64/boot/dts/mediatek/mt8188-geralt-ciri-sku1.dts create mode 100644 arch/arm64/boot/dts/mediatek/mt8188-geralt-ciri-sku2.dts create mode 100644 arch/arm64/boot/dts/mediatek/mt8188-geralt-ciri-sku3.dts create mode 100644 arch/arm64/boot/dts/mediatek/mt8188-geralt-ciri-sku4.dts create mode 100644 arch/arm64/boot/dts/mediatek/mt8188-geralt-ciri-sku5.dts create mode 100644 arch/arm64/boot/dts/mediatek/mt8188-geralt-ciri-sku6.dts create mode 100644 arch/arm64/boot/dts/mediatek/mt8188-geralt-ciri-sku7.dts create mode 100644 arch/arm64/boot/dts/mediatek/mt8188-geralt-ciri.dtsi create mode 100644 arch/arm64/boot/dts/mediatek/mt8188-geralt.dtsi delete mode 100644 arch/arm64/boot/dts/mediatek/mt8192-asurada-hayato-r5-sku2.dts delete mode 100644 arch/arm64/boot/dts/mediatek/mt8192-asurada-spherion-r4.dts create mode 100644 arch/arm64/boot/dts/qcom/ipq5424-rdp466.dts create mode 100644 arch/arm64/boot/dts/qcom/ipq5424.dtsi create mode 100644 arch/arm64/boot/dts/qcom/msm8917-xiaomi-riva.dts create mode 100644 arch/arm64/boot/dts/qcom/msm8917.dtsi create mode 100644 arch/arm64/boot/dts/qcom/pm8937.dtsi create mode 100644 arch/arm64/boot/dts/qcom/pmd8028.dtsi create mode 100644 arch/arm64/boot/dts/qcom/pmih0108.dtsi create mode 100644 arch/arm64/boot/dts/qcom/qcs615-ride.dts create mode 100644 arch/arm64/boot/dts/qcom/qcs615.dtsi create mode 100644 arch/arm64/boot/dts/qcom/qcs8300-ride.dts create mode 100644 arch/arm64/boot/dts/qcom/qcs8300.dtsi create mode 100644 arch/arm64/boot/dts/qcom/sar2130p-qar2130p.dts create mode 100644 arch/arm64/boot/dts/qcom/sar2130p.dtsi create mode 100644 arch/arm64/boot/dts/qcom/sc8280xp-huawei-gaokun3.dts create mode 100644 arch/arm64/boot/dts/qcom/sc8280xp-microsoft-blackrock.dts create mode 100644 arch/arm64/boot/dts/qcom/sm8750-mtp.dts create mode 100644 arch/arm64/boot/dts/qcom/sm8750-pmics.dtsi create mode 100644 arch/arm64/boot/dts/qcom/sm8750-qrd.dts create mode 100644 arch/arm64/boot/dts/qcom/sm8750.dtsi create mode 100644 arch/arm64/boot/dts/qcom/x1e001de-devkit.dts create mode 100644 arch/arm64/boot/dts/qcom/x1e80100-hp-omnibook-x14.dts create mode 100644 arch/arm64/boot/dts/renesas/r8a779g3-white-hawk-single.dts create mode 100644 arch/arm64/boot/dts/renesas/r8a779g3.dtsi create mode 100644 arch/arm64/boot/dts/renesas/r9a09g047.dtsi create mode 100644 arch/arm64/boot/dts/renesas/r9a09g047e37.dtsi create mode 100644 arch/arm64/boot/dts/renesas/r9a09g047e57-smarc.dts create mode 100644 arch/arm64/boot/dts/renesas/r9a09g047e57.dtsi create mode 100644 arch/arm64/boot/dts/renesas/renesas-smarc2.dtsi create mode 100644 arch/arm64/boot/dts/renesas/rzg3e-smarc-som.dtsi rename arch/arm64/boot/dts/renesas/{r8a779g0-white-hawk-ard-audio-da7212.dtso => white-hawk-ard-audio-da7212.dtso} (96%) create mode 100644 arch/arm64/boot/dts/renesas/white-hawk-single.dtsi create mode 100644 arch/arm64/boot/dts/rockchip/rk3566-bigtreetech-cb2-manta.dts create mode 100644 arch/arm64/boot/dts/rockchip/rk3566-bigtreetech-cb2.dtsi create mode 100644 arch/arm64/boot/dts/rockchip/rk3566-bigtreetech-pi2.dts create mode 100644 arch/arm64/boot/dts/rockchip/rk3576-evb1-v10.dts create mode 100644 arch/arm64/boot/dts/rockchip/rk3582-radxa-e52c.dts create mode 100644 arch/arm64/boot/dts/rockchip/rk3588-firefly-core-3588j.dtsi create mode 100644 arch/arm64/boot/dts/rockchip/rk3588-firefly-itx-3588j.dts create mode 100644 arch/arm64/boot/dts/rockchip/rk3588-h96-max-v58.dts create mode 100644 arch/arm64/boot/dts/rockchip/rk3588-orangepi-5-compact.dtsi create mode 100644 arch/arm64/boot/dts/rockchip/rk3588-orangepi-5-max.dts create mode 100644 arch/arm64/boot/dts/rockchip/rk3588-orangepi-5.dtsi rename arch/arm64/boot/dts/ti/{k3-am642-hummingboard-t-pcie.dtso => k3-am642-hummingboard-t-pcie.dts} (78%) rename arch/arm64/boot/dts/ti/{k3-am642-hummingboard-t-usb3.dtso => k3-am642-hummingboard-t-usb3.dts} (74%) create mode 100644 arch/arm64/boot/dts/ti/k3-am68-sk-base-board-pcie1-ep.dtso create mode 100644 arch/arm64/boot/dts/ti/k3-am69-sk-pcie0-ep.dtso create mode 100644 arch/arm64/boot/dts/ti/k3-j721e-evm-pcie1-ep.dtso create mode 100644 include/dt-bindings/clock/qcom,ipq-cmn-pll.h create mode 100644 include/dt-bindings/clock/qcom,qcs615-gcc.h create mode 100644 include/dt-bindings/clock/qcom,sm8750-dispcc.h create mode 100644 include/dt-bindings/clock/qcom,sm8750-gcc.h create mode 100644 include/dt-bindings/clock/qcom,sm8750-tcsr.h create mode 100644 include/dt-bindings/clock/renesas,r9a09g047-cpg.h create mode 100644 include/dt-bindings/clock/samsung,exynos990.h create mode 100644 include/dt-bindings/interconnect/qcom,sm8750-rpmh.h create mode 100644 include/dt-bindings/pinctrl/renesas,r9a09g047-pinctrl.h create mode 100644 include/dt-bindings/pinctrl/renesas,r9a09g057-pinctrl.h From patchwork Fri Jan 24 15:08:27 2025 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: Arnd Bergmann X-Patchwork-Id: 13949548 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from bombadil.infradead.org (bombadil.infradead.org [198.137.202.133]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by smtp.lore.kernel.org (Postfix) with ESMTPS id 9DBB1C02181 for ; Fri, 24 Jan 2025 15:12:05 +0000 (UTC) DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed; d=lists.infradead.org; s=bombadil.20210309; h=Sender:List-Subscribe:List-Help :List-Post:List-Archive:List-Unsubscribe:List-Id:Content-Transfer-Encoding: Content-Type:Subject:References:In-Reply-To:Message-Id:Cc:To:From:Date: MIME-Version:Reply-To:Content-ID:Content-Description:Resent-Date:Resent-From: Resent-Sender:Resent-To:Resent-Cc:Resent-Message-ID:List-Owner; bh=ZJ4WtcWb4pGQvvZfqyG6MRraoEe/+wFppxa1Noh1do8=; b=aRfkeF9ZO8eBjtciAd1YKTLdrF aupIdrmPHkdCDUXdoQ8S9NVHbowvp93/RbLMNnMEZMX4/LGULCFrlTuTmPAHRlnL/RodgW91yIVg6 T84AjwsJaBtHD/M2clIKRKOHjQttf5u3i/wmeJPuFfcW4I9PyRV+TA463T621O6lGKZEw1ayFM4i/ U7xy04Tm7iG3UzQdjvZ7tWYBXZUnvjmBOgaolwXcdR3k8bycHdhZfjCo4BGdQ+SwgDpYWlrkrTNam wsZQUA+k4Ft/hTUqwaGC6Q1zSmpdYnmy8DKTtiqSlGTrR2Qjdr7bR7TCUY0G7x55OHasRS84hMIVu 9eqEcbnQ==; Received: from localhost ([::1] helo=bombadil.infradead.org) by bombadil.infradead.org with esmtp (Exim 4.98 #2 (Red Hat Linux)) id 1tbLLZ-0000000EvbG-4469; Fri, 24 Jan 2025 15:11:49 +0000 Received: from fhigh-a6-smtp.messagingengine.com ([103.168.172.157]) by bombadil.infradead.org with esmtps (Exim 4.98 #2 (Red Hat Linux)) id 1tbLIy-0000000EvBv-3TdT for linux-arm-kernel@lists.infradead.org; Fri, 24 Jan 2025 15:09:10 +0000 Received: from phl-compute-10.internal (phl-compute-10.phl.internal [10.202.2.50]) by mailfhigh.phl.internal (Postfix) with ESMTP id 23D5211401A4; Fri, 24 Jan 2025 10:09:08 -0500 (EST) Received: from phl-imap-11 ([10.202.2.101]) by phl-compute-10.internal (MEProxy); Fri, 24 Jan 2025 10:09:08 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=arndb.de; h=cc :cc:content-transfer-encoding:content-type:content-type:date :date:from:from:in-reply-to:in-reply-to:message-id:mime-version :references:reply-to:subject:subject:to:to; s=fm2; t=1737731348; x=1737817748; bh=ZJ4WtcWb4pGQvvZfqyG6MRraoEe/+wFppxa1Noh1do8=; b= lfjw9NFqAAebimBslj45njcfoOL9yc9AcqOGdXddzqiSGzSKOGe6Qy/rrEZXnh1X t73DgOCIi2WDgSbN86oVcVQ5Hh+jq8PFf1H2U4tpHFDpiRFnEegI0/zW2HOdWCu5 iruFFA1UFOliZL4F6+slpcNZofiqhdZ0p1h2m4gdHtxHqlyqhg7XXaPj5mqnfaag lGUeUUGmFEHuf1N8ZJAg6s51ToTHPuAvs1ruPOyn7We04tSA8F1T7Drw95lEmlYT C1FxAdHAzwaP+SzO2TvysQ/k9nH42+kBpNjXVMJ1hwV5rcC6umxFTPUniHMaQx48 i8OKVZMl7UUmsiUyZcNEYw== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:cc:content-transfer-encoding :content-type:content-type:date:date:feedback-id:feedback-id :from:from:in-reply-to:in-reply-to:message-id:mime-version :references:reply-to:subject:subject:to:to:x-me-proxy :x-me-sender:x-me-sender:x-sasl-enc; s=fm3; t=1737731348; x= 1737817748; bh=ZJ4WtcWb4pGQvvZfqyG6MRraoEe/+wFppxa1Noh1do8=; b=w L7taxRQgcnEdbvCEUx8nOxWd/A4rz+GTKepCyuTKjHVI8JdgzUNnPNtrE9KgB8Dr HXjre+MxixX2PV+REvo/vJlHk/fnV7LQXlwb+ybBrn9kyi2JjcjGVGNIU1RCZcQs 2CbY8MgtlvWe+dC3iGxcI/dP3hOESALKtIyQZYqUpkXw0knR6/6VvB8aYeipsXjG XolhYzRnzQ1wVdHTjeu2RSG5qKV3XbnendxLVlQ57Zo2H2vFwNEdxL66PUAA3HIl UIaeMNuM3kEuU2AEmF8Bqn4byaJN7I6hK0BmVgN1+b6tC0E3Q1rQIy1Jlif2NOFg K2hteLSvWy3z7oEB2gIZA== X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeefuddrudejgedggeekfecutefuodetggdotefrod ftvfcurfhrohhfihhlvgemucfhrghsthforghilhdpggftfghnshhusghstghrihgsvgdp uffrtefokffrpgfnqfghnecuuegrihhlohhuthemuceftddtnecusecvtfgvtghiphhivg hnthhsucdlqddutddtmdenucfjughrpefoggffhffvvefkjghfufgtgfesthejredtredt tdenucfhrhhomhepfdetrhhnugcuuegvrhhgmhgrnhhnfdcuoegrrhhnugesrghrnhgusg druggvqeenucggtffrrghtthgvrhhnpeejueeluedtteehvefhhedvueeivdeugffghedv kedtgfdtheejudejieehleeuheenucffohhmrghinhepkhgvrhhnvghlrdhorhhgpdhgih hthhhusgdrtghomhdplhhinhgrrhhordhorhhgpdhpvghnghhuthhrohhnihigrdguvgen ucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepmhgrihhlfhhrohhmpegrrhhnug esrghrnhgusgdruggvpdhnsggprhgtphhtthhopeegpdhmohguvgepshhmthhpohhuthdp rhgtphhtthhopehtohhrvhgrlhgusheslhhinhhugidqfhhouhhnuggrthhiohhnrdhorh hgpdhrtghpthhtoheplhhinhhugidqrghrmhdqkhgvrhhnvghlsehlihhsthhsrdhinhhf rhgruggvrggurdhorhhgpdhrtghpthhtohepshhotgeslhhishhtshdrlhhinhhugidrug gvvhdprhgtphhtthhopehlihhnuhigqdhkvghrnhgvlhesvhhgvghrrdhkvghrnhgvlhdr ohhrgh X-ME-Proxy: Feedback-ID: i56a14606:Fastmail Received: by mailuser.phl.internal (Postfix, from userid 501) id A53E92220072; Fri, 24 Jan 2025 10:09:07 -0500 (EST) X-Mailer: MessagingEngine.com Webmail Interface MIME-Version: 1.0 Date: Fri, 24 Jan 2025 16:08:27 +0100 From: "Arnd Bergmann" To: "Linus Torvalds" Cc: linux-kernel@vger.kernel.org, linux-arm-kernel@lists.infradead.org, soc@lists.linux.dev Message-Id: In-Reply-To: <1f0939fd-1694-476e-954f-e58ff8650dd9@app.fastmail.com> References: <1f0939fd-1694-476e-954f-e58ff8650dd9@app.fastmail.com> Subject: [GIT PULL 4/5] soc: driver updates for 6.14 X-CRM114-Version: 20100106-BlameMichelson ( TRE 0.8.0 (BSD) ) MR-646709E3 X-CRM114-CacheID: sfid-20250124_070909_027084_BBB5770D X-CRM114-Status: GOOD ( 15.82 ) X-BeenThere: linux-arm-kernel@lists.infradead.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Sender: "linux-arm-kernel" Errors-To: linux-arm-kernel-bounces+linux-arm-kernel=archiver.kernel.org@lists.infradead.org The following changes since commit fac04efc5c793dccbd07e2d59af9f90b7fc0dca4: Linux 6.13-rc2 (2024-12-08 14:03:39 -0800) are available in the Git repository at: https://git.kernel.org/pub/scm/linux/kernel/git/soc/soc.git tags/soc-drivers-6.14 for you to fetch changes up to 9ec80025030b0492512e01e2e667f4111c583b46: Merge tag 'litex-6.13-rc1' of https://github.com/litex-hub/linux into soc/drivers (2025-01-22 14:35:25 +0100) ---------------------------------------------------------------- soc: driver updates for 6.14 These are changes to SoC specific drivers and DT bindings that don't have a separate subsystem tree, or that get grouped here for simplicity. Nothing out of the ordinary for the 6.14 release here: - Most of the updates are for Qualcomm specific drivers, adding support for additional SoCs in the exssting drivers, and support for wrapped encryption key access in the SCM firmware. - The Arm SCMI firmware code gains support for having multiple instances of firmware running, and better module auto loading. - A few minor updates for litex, samsung, ti, tegra, mediatek, imx and renesas platforms. - Reset controller updates for amlogic, to add support for the A1 soc and clean up the existing code. - Memory controller updates for ti davinci aemif, refactoring the code and adding a few interfaces to other drivers. ---------------------------------------------------------------- Andrew Davis (1): drivers/soc/litex: Use devm_register_restart_handler() Arnd Bergmann (13): Merge tag 'renesas-drivers-for-v6.14-tag1' of https://git.kernel.org/pub/scm/linux/kernel/git/geert/renesas-devel into soc/drivers Merge tag 'optee-for-v6.14' of https://git.linaro.org/people/jens.wiklander/linux-tee into soc/drivers Merge tag 'memory-controller-drv-6.14' of https://git.kernel.org/pub/scm/linux/kernel/git/krzk/linux-mem-ctrl into soc/drivers Merge tag 'memory-controller-drv-ti-6.14' of https://git.kernel.org/pub/scm/linux/kernel/git/krzk/linux-mem-ctrl into soc/drivers Merge tag 'scmi-updates-6.14' of https://git.kernel.org/pub/scm/linux/kernel/git/sudeep.holla/linux into soc/drivers Merge tag 'imx-drivers-6.14' of https://git.kernel.org/pub/scm/linux/kernel/git/shawnguo/linux into soc/drivers Merge tag 'mtk-soc-for-v6.14' of https://git.kernel.org/pub/scm/linux/kernel/git/mediatek/linux into soc/drivers Merge tag 'tegra-for-6.14-soc' of https://git.kernel.org/pub/scm/linux/kernel/git/tegra/linux into soc/drivers Merge tag 'ti-k3-maintainer-for-v6.14' of https://git.kernel.org/pub/scm/linux/kernel/git/ti/linux into soc/drivers Merge tag 'qcom-drivers-for-6.14' of https://git.kernel.org/pub/scm/linux/kernel/git/qcom/linux into soc/drivers Merge tag 'samsung-drivers-6.14' of https://git.kernel.org/pub/scm/linux/kernel/git/krzk/linux into soc/drivers Merge tag 'reset-for-v6.14-2' of git://git.pengutronix.de/pza/linux into soc/drivers Merge tag 'litex-6.13-rc1' of https://github.com/litex-hub/linux into soc/drivers Bartosz Golaszewski (2): soc: qcom: rmtfs: allow building the module with COMPILE_TEST=y soc: qcom: rmtfs: constify rmtfs_class Bastien Curutchet (6): memory: ti-aemif: Store timings parameter in number of cycles - 1 memory: ti-aemif: Remove unnecessary local variables memory: ti-aemif: Wrap CS timings into a struct memory: ti-aemif: Create aemif_check_cs_timings() memory: ti-aemif: Create aemif_set_cs_timings() memory: ti-aemif: Export aemif_*_cs_timings() Biju Das (1): soc: renesas: Add RZ/G3E (R9A09G047) config option Cristian Marussi (4): firmware: arm_scmi: Allow transport properties for multiple instances firmware: arm_scmi: Support vendor protocol modules autoloading firmware: arm_scmi: Add module aliases to i.MX vendor protocols firmware: arm_scmi: Add aliases to transport modules Dr. David Alan Gilbert (1): memory: omap-gpmc: deadcode a pair of functions Eugen Hristev (1): soc: qcom: Rework BCM_TCS_CMD macro Gaurav Kashyap (1): firmware: qcom: scm: add calls for wrapped key support Ivaylo Ivanov (1): dt-bindings: soc: samsung: exynos-sysreg: add sysreg compatibles for exynos8895 Jan Dakinevich (2): dt-bindings: reset: add bindings for A1 SoC audio reset controller reset: amlogic: add support for A1 SoC in auxiliary reset driver Jens Glathe (2): firmware: qcom: scm: Allow QSEECOM for HP Omnibook X14 firmware: qcom: scm: Allow QSEECOM for Windows Dev Kit 2023 Jerome Brunet (3): clk: amlogic: axg-audio: revert reset implementation reset: amlogic: aux: get regmap through parent device reset: amlogic: aux: drop aux registration helper Joe Hattori (1): memory: tegra20-emc: fix an OF node reference bug in tegra_emc_find_node_by_ram_code() Johan Hovold (1): Revert "clk: Fix invalid execution of clk_set_rate" Kartik Rajput (1): soc/tegra: fuse: Update Tegra234 nvmem keepout list Konrad Dybcio (3): soc: qcom: pd-mapper: Add X1P42100 firmware: qcom: scm: Allow QSEECOM on X1P42100 CRD soc: qcom: llcc: Enable LLCC_WRCACHE at boot on X1 Krzysztof Kozlowski (13): soc: qcom: pmic_glink: simplify locking with guard() soc: qcom: smem_state: fix missing of_node_put in error path soc: qcom: pmic_glink_altmode: simplify locking with guard() dt-bindings: samsung: exynos-usi: Restrict possible samsung,mode values soc: samsung: exynos-pmu: Fix uninitialized ret in tensor_set_bits_atomic() firmware: qcom: scm: Fix missing read barrier in qcom_scm_is_available() firmware: qcom: scm: Fix missing read barrier in qcom_scm_get_tzmem_pool() firmware: qcom: scm: Cleanup global '__scm' on probe failures firmware: qcom: scm: smc: Handle missing SCM device firmware: qcom: scm: smc: Narrow 'mempool' variable scope soc: mediatek: mtk-devapc: Fix leaking IO map on error paths soc: mediatek: mtk-devapc: Fix leaking IO map on driver remove soc/tegra: cbb: Drop unnecessary debugfs error handling Kyle Deng (1): dt-bindings: soc: qcom,aoss-qmp: Document the qcs615 Lijuan Gao (1): dt-bindings: interconnect: qcom-bwmon: Document QCS615 bwmon compatibles Luca Weiss (1): soc: qcom: pd_mapper: Add SM7225 compatible MD Danish Anwar (1): MAINTAINERS: Add entry for linux/pruss_driver.h Manikanta Mylavarapu (1): dt-bindings: firmware: qcom,scm: Document ipq5424 SCM Maud Spierings (1): firmware: qcom: scm: Allow QSEECOM on the asus vivobook s15 Pengyu Luo (1): firmware: qcom: scm: Allow QSEECOM on Huawei Matebook E Go (sc8280xp) Qingqing Zhou (1): dt-bindings: firmware: qcom,scm: document QCS615 SCM Sahil Malhotra (1): optee: fix format string for printing optee build_id Stephan Gerhold (1): soc: qcom: socinfo: Avoid out of bounds read of serial number Varadarajan Narayanan (2): dt-bindings: cache: qcom,llcc: Add IPQ5424 compatible soc: qcom: llcc: Update configuration data for IPQ5424 Wasim Nazir (2): dt-bindings: arm: qcom,ids: add SoC ID for QCS9075 soc: qcom: socinfo: add QCS9075 SoC ID alice.guo (1): soc: imx: Add SoC device register for i.MX9 liujing (1): soc/tegra: Fix spelling error in tegra234_lookup_slave_timeout() .../devicetree/bindings/cache/qcom,llcc.yaml | 20 +- .../devicetree/bindings/firmware/qcom,scm.yaml | 2 + .../bindings/interconnect/qcom,msm8998-bwmon.yaml | 2 + .../bindings/soc/qcom/qcom,aoss-qmp.yaml | 1 + .../bindings/soc/samsung/exynos-usi.yaml | 1 + .../soc/samsung/samsung,exynos-sysreg.yaml | 8 + MAINTAINERS | 1 + drivers/clk/clk.c | 2 +- drivers/clk/meson/Kconfig | 2 +- drivers/clk/meson/axg-audio.c | 109 ++++++++- drivers/firmware/arm_scmi/common.h | 4 +- drivers/firmware/arm_scmi/driver.c | 74 ++++-- drivers/firmware/arm_scmi/transports/mailbox.c | 1 + drivers/firmware/arm_scmi/transports/smc.c | 1 + drivers/firmware/arm_scmi/transports/virtio.c | 1 + drivers/firmware/arm_scmi/vendors/imx/imx-sm-bbm.c | 5 +- .../firmware/arm_scmi/vendors/imx/imx-sm-misc.c | 5 +- drivers/firmware/qcom/qcom_scm-smc.c | 6 +- drivers/firmware/qcom/qcom_scm.c | 271 +++++++++++++++++++-- drivers/firmware/qcom/qcom_scm.h | 4 + drivers/memory/omap-gpmc.c | 33 +-- drivers/memory/tegra/tegra20-emc.c | 8 +- drivers/memory/ti-aemif.c | 192 +++++++++------ drivers/reset/amlogic/reset-meson-aux.c | 97 ++------ drivers/soc/imx/Makefile | 2 +- drivers/soc/imx/soc-imx9.c | 128 ++++++++++ drivers/soc/litex/litex_soc_ctrl.c | 23 +- drivers/soc/mediatek/mtk-devapc.c | 19 +- drivers/soc/qcom/Kconfig | 2 +- drivers/soc/qcom/llcc-qcom.c | 58 ++++- drivers/soc/qcom/pmic_glink.c | 70 +++--- drivers/soc/qcom/pmic_glink_altmode.c | 11 +- drivers/soc/qcom/qcom_pd_mapper.c | 2 + drivers/soc/qcom/rmtfs_mem.c | 2 +- drivers/soc/qcom/smem_state.c | 3 +- drivers/soc/qcom/socinfo.c | 3 +- drivers/soc/renesas/Kconfig | 5 + drivers/soc/samsung/exynos-pmu.c | 2 +- drivers/soc/tegra/cbb/tegra-cbb.c | 20 +- drivers/soc/tegra/cbb/tegra234-cbb.c | 2 +- drivers/soc/tegra/fuse/fuse-tegra30.c | 17 +- drivers/tee/optee/smc_abi.c | 5 +- include/dt-bindings/arm/qcom,ids.h | 1 + .../reset/amlogic,meson-a1-audio-reset.h | 36 +++ include/linux/firmware/qcom/qcom_scm.h | 8 + include/linux/memory/ti-aemif.h | 32 +++ include/linux/omap-gpmc.h | 4 - include/linux/scmi_imx_protocol.h | 9 +- include/soc/amlogic/reset-meson-aux.h | 23 -- include/soc/qcom/tcs.h | 26 +- 50 files changed, 978 insertions(+), 385 deletions(-) create mode 100644 drivers/soc/imx/soc-imx9.c create mode 100644 include/dt-bindings/reset/amlogic,meson-a1-audio-reset.h create mode 100644 include/linux/memory/ti-aemif.h delete mode 100644 include/soc/amlogic/reset-meson-aux.h From patchwork Fri Jan 24 15:08:59 2025 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 8bit X-Patchwork-Submitter: Arnd Bergmann X-Patchwork-Id: 13949633 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from bombadil.infradead.org (bombadil.infradead.org [198.137.202.133]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by smtp.lore.kernel.org (Postfix) with ESMTPS id 8052BC02181 for ; Fri, 24 Jan 2025 15:14:44 +0000 (UTC) DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed; d=lists.infradead.org; s=bombadil.20210309; h=Sender:List-Subscribe:List-Help :List-Post:List-Archive:List-Unsubscribe:List-Id:Content-Transfer-Encoding: Content-Type:Subject:References:In-Reply-To:Message-Id:Cc:To:From:Date: MIME-Version:Reply-To:Content-ID:Content-Description:Resent-Date:Resent-From: Resent-Sender:Resent-To:Resent-Cc:Resent-Message-ID:List-Owner; bh=+0Mqs7iOlVquPP3UP3a2iTIsdV7BIk9K1d6vObYVMh0=; b=uXCufTRCQ8ejvtluv3Y+I7DGhQ olxEbfzyfKRgFkAmwHDKL5ox86fOcwfKrsU1h84QPmgwuLfldVSMYq1QR86uCtF9GnTsW5Na8M++R 5hfAWkjgm8rIcd4k8Mw0sqv6N20lpMwfHpAqq52+YtUbHIYl74+EFvl0B6nlGIQ0j9g5hsXz00+mx LMGjuEwa4Yc8bIJsgGJLu1yMl/jDWIaDOSNkEEvPZg7U1IUJ8v9l+vYbfLyDcmTAb2ne1WBVFz3qa +dbKW3JHCRsSoeaRqU2WUJKm5rVgeEvKGUoPa73Abm95HWXvXB1aMe61b7IP7yb6wROGG0WXCunh+ Xdrb+law==; Received: from localhost ([::1] helo=bombadil.infradead.org) by bombadil.infradead.org with esmtp (Exim 4.98 #2 (Red Hat Linux)) id 1tbLOA-0000000Ew6I-2yEO; Fri, 24 Jan 2025 15:14:30 +0000 Received: from fhigh-a6-smtp.messagingengine.com ([103.168.172.157]) by bombadil.infradead.org with esmtps (Exim 4.98 #2 (Red Hat Linux)) id 1tbLJB-0000000EvFW-0EE9 for linux-arm-kernel@lists.infradead.org; Fri, 24 Jan 2025 15:09:22 +0000 Received: from phl-compute-10.internal (phl-compute-10.phl.internal [10.202.2.50]) by mailfhigh.phl.internal (Postfix) with ESMTP id 581E611401A8; Fri, 24 Jan 2025 10:09:20 -0500 (EST) Received: from phl-imap-11 ([10.202.2.101]) by phl-compute-10.internal (MEProxy); Fri, 24 Jan 2025 10:09:20 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=arndb.de; h=cc :cc:content-transfer-encoding:content-type:content-type:date :date:from:from:in-reply-to:in-reply-to:message-id:mime-version :references:reply-to:subject:subject:to:to; s=fm2; t=1737731360; x=1737817760; bh=+0Mqs7iOlVquPP3UP3a2iTIsdV7BIk9K1d6vObYVMh0=; b= djkfvsz8J8u3SJzI3ErSHCzD19Lq3r7BDohbMwF3iH8cb9KuDcO7a5jPhDn/0BgS wLnMjqbbfLsct/NzzMBRPE+CF9nVXF+OUlaZWdV/Fl948iJp5aM+Z4APTq7uxTvL svrZAXOC5L1fjyrI5whs1nCdBaJ5AVNLBMk5AH5lFT4ucG7GBStH1h8pGFoDu5o2 +XQhOvOy0JMa4tOIbVVjj7jIP0Q2FE6V0u8E10HDkM9nrgDoIkT8qN9BCueAhSNH o1KRjSP/qEHZflVqgOMYvjuKlNJJdtCiwdkNTqrx51FZFFAhrBGz4SFUR/6CY2t2 Q7m9o5CSUAgCuNF7kGNrFQ== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:cc:content-transfer-encoding :content-type:content-type:date:date:feedback-id:feedback-id :from:from:in-reply-to:in-reply-to:message-id:mime-version :references:reply-to:subject:subject:to:to:x-me-proxy :x-me-sender:x-me-sender:x-sasl-enc; s=fm3; t=1737731360; x= 1737817760; bh=+0Mqs7iOlVquPP3UP3a2iTIsdV7BIk9K1d6vObYVMh0=; b=d W1ufnZXXMMFbPAc0NCL78MseC8HPfgVLzgN5JoLOlmWuyS5tedyuGxLouzCo5zYH 4OFJD+Q6zGNnwnT2fTlvyCZbP0SU9fu4tXYZx6TIKp4mMtpBZriNJzkbIU1axXNt mj7kb0oBzRKqKNPACOFuEMizd0zUUHTFX7YcKxbHqW47+Ht2VD+87BZCjt88nmIy Rbblw3vZdvYE/93rNIQnFB0vdWG882bcnp2zBCmKKMrN9mfnXiZn+HP4SJsIGPk8 OLMjLKT6YtHl7STOgb0jTV2JhHe87Bcvd7VZNVM+yag1ncnZAxb46zCXBYl6Txnl a+PIBaX9StV97zuwD9H4A== X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeefuddrudejgedggeekfecutefuodetggdotefrod ftvfcurfhrohhfihhlvgemucfhrghsthforghilhdpggftfghnshhusghstghrihgsvgdp uffrtefokffrpgfnqfghnecuuegrihhlohhuthemuceftddtnecusecvtfgvtghiphhivg hnthhsucdlqddutddtmdenucfjughrpefoggffhffvvefkjghfufgtgfesthhqredtredt jeenucfhrhhomhepfdetrhhnugcuuegvrhhgmhgrnhhnfdcuoegrrhhnugesrghrnhgusg druggvqeenucggtffrrghtthgvrhhnpeefueegkeffveeugeehieehiedukeegfefhffeu tdettdffteeluefhheetkeekvdenucffohhmrghinhepkhgvrhhnvghlrdhorhhgpdhgih hthhhusgdrtghomhenucevlhhushhtvghrufhiiigvpedunecurfgrrhgrmhepmhgrihhl fhhrohhmpegrrhhnugesrghrnhgusgdruggvpdhnsggprhgtphhtthhopeegpdhmohguvg epshhmthhpohhuthdprhgtphhtthhopehtohhrvhgrlhgusheslhhinhhugidqfhhouhhn uggrthhiohhnrdhorhhgpdhrtghpthhtoheplhhinhhugidqrghrmhdqkhgvrhhnvghlse hlihhsthhsrdhinhhfrhgruggvrggurdhorhhgpdhrtghpthhtohepshhotgeslhhishht shdrlhhinhhugidruggvvhdprhgtphhtthhopehlihhnuhigqdhkvghrnhgvlhesvhhgvg hrrdhkvghrnhgvlhdrohhrgh X-ME-Proxy: Feedback-ID: i56a14606:Fastmail Received: by mailuser.phl.internal (Postfix, from userid 501) id 202942220074; Fri, 24 Jan 2025 10:09:20 -0500 (EST) X-Mailer: MessagingEngine.com Webmail Interface MIME-Version: 1.0 Date: Fri, 24 Jan 2025 16:08:59 +0100 From: "Arnd Bergmann" To: "Linus Torvalds" Cc: linux-kernel@vger.kernel.org, linux-arm-kernel@lists.infradead.org, soc@lists.linux.dev Message-Id: In-Reply-To: <1f0939fd-1694-476e-954f-e58ff8650dd9@app.fastmail.com> References: <1f0939fd-1694-476e-954f-e58ff8650dd9@app.fastmail.com> Subject: [GIT PULL 5/5] soc: defconfig updates for 6.14 X-CRM114-Version: 20100106-BlameMichelson ( TRE 0.8.0 (BSD) ) MR-646709E3 X-CRM114-CacheID: sfid-20250124_070921_166783_F5BDFD54 X-CRM114-Status: UNSURE ( 8.89 ) X-CRM114-Notice: Please train this message. X-BeenThere: linux-arm-kernel@lists.infradead.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Sender: "linux-arm-kernel" Errors-To: linux-arm-kernel-bounces+linux-arm-kernel=archiver.kernel.org@lists.infradead.org The following changes since commit fac04efc5c793dccbd07e2d59af9f90b7fc0dca4: Linux 6.13-rc2 (2024-12-08 14:03:39 -0800) are available in the Git repository at: https://git.kernel.org/pub/scm/linux/kernel/git/soc/soc.git tags/soc-defconfig-6.14 for you to fetch changes up to 309f64469cd5d09d5f1207e57d42f2eff9bd9311: Merge tag 'arm-soc/for-6.14/defconfig-arm64' of https://github.com/Broadcom/stblinux into soc/defconfig (2025-01-24 13:08:51 +0100) ---------------------------------------------------------------- soc: defconfig updates for 6.14 As usual, a number of new drivers get added to the defconfig to support additional hardware. The stm32 defconfig also turns off a few options to optimize for size. ---------------------------------------------------------------- Alexander Stein (1): ARM: imx_v6_v7_defconfig: enable JC42 for TQMa7x André Draszik (1): arm64: defconfig: enable Maxim TCPCI driver Arnd Bergmann (9): Merge tag 'renesas-arm-defconfig-for-v6.14-tag1' of https://git.kernel.org/pub/scm/linux/kernel/git/geert/renesas-devel into soc/defconfig Merge tag 'imx-defconfig-6.14' of https://git.kernel.org/pub/scm/linux/kernel/git/shawnguo/linux into soc/defconfig Merge tag 'at91-defconfig-6.14' of https://git.kernel.org/pub/scm/linux/kernel/git/at91/linux into soc/defconfig Merge tag 'mtk-defconfig-for-v6.14' of https://git.kernel.org/pub/scm/linux/kernel/git/mediatek/linux into soc/defconfig Merge tag 'ti-k3-config-for-v6.14' of https://git.kernel.org/pub/scm/linux/kernel/git/ti/linux into soc/defconfig Merge tag 'v6.14-rockchip-defconfig64-1' of https://git.kernel.org/pub/scm/linux/kernel/git/mmind/linux-rockchip into soc/defconfig Merge tag 'qcom-arm64-defconfig-for-6.14' of https://git.kernel.org/pub/scm/linux/kernel/git/qcom/linux into soc/defconfig Merge tag 'riscv-config-for-v6.14' of https://git.kernel.org/pub/scm/linux/kernel/git/conor/linux into soc/defconfig Merge tag 'arm-soc/for-6.14/defconfig-arm64' of https://github.com/Broadcom/stblinux into soc/defconfig Biju Das (1): arm64: defconfig: Enable R9A09G047 SoC Cristian Ciocaltea (1): arm64: defconfig: Enable Rockchip extensions for Synopsys DW HDMI QP Drew Fustini (1): riscv: defconfig: enable pinctrl and dwmac support for TH1520 Geert Uytterhoeven (1): ARM: shmobile: defconfig: Refresh for v6.13-rc1 Hari Nagalla (1): arm64: defconfig: Enable TI K3 M4 remoteproc driver Igor Belwon (1): dt-bindings: soc: samsung: exynos-pmu: Add exynos990-pmu compatible Jingyi Wang (1): arm64: defconfig: enable clock controller, interconnect and pinctrl for QCS8300 Krzysztof Kozlowski (1): arm64: defconfig: Enable basic Qualcomm SM8750 SoC drivers Lad Prabhakar (1): arm64: defconfig: Enable Renesas RZ/V2H(P) Watchdog driver Lijuan Gao (1): arm64: defconfig: enable clock controller, interconnect and pinctrl for QCS615 Liu Ying (1): arm64: defconfig: Enable ITE IT6263 driver Luo Jie (1): arm64: defconfig: Enable Qualcomm IPQ CMN PLL clock controller Mark Brown (1): arm64: defconfig: Enable Amazon Elastic Network Adaptor Nicolas Dufresne (1): arm64: defconfig: Enable RFKILL GPIO Nícolas F. R. A. Prado (3): arm64: defconfig: Enable MediaTek STAR Ethernet MAC arm64: defconfig: Enable sound for MT8188 arm64: defconfig: Enable MediaTek DWMAC Patrice Chotard (4): ARM: configs: stm32: Remove FLASH_MEM_BASE and FLASH_SIZE in STM32 defconfig ARM: configs: stm32: Clean STM32 defconfig ARM: configs: stm32: Remove CRYPTO in STM32 defconfig ARM: configs: stm32: Remove useless flags in STM32 defconfig Ross Burton (1): arm64: defconfig: remove obsolete CONFIG_SM_DISPCC_8650 Ryan Wanner (1): ARM: configs: at91: sama7: add new SoC config Stefan Wahren (1): arm64: defconfig: Enable pinctrl-based I2C mux Taniya Das (1): arm64: defconfig: Enable sa8775p clock controllers .../bindings/soc/samsung/exynos-pmu.yaml | 1 + arch/arm/configs/imx_v6_v7_defconfig | 1 + arch/arm/configs/multi_v7_defconfig | 1 + arch/arm/configs/sama7_defconfig | 1 + arch/arm/configs/shmobile_defconfig | 1 + arch/arm/configs/stm32_defconfig | 12 ++++----- arch/arm64/configs/defconfig | 31 +++++++++++++++++++++- arch/riscv/configs/defconfig | 2 ++ 8 files changed, 43 insertions(+), 7 deletions(-)